Recombinant Mouse Amphiregulin (Areg), partial

In Stock
Code CSB-EP001986MO1
Abbreviation Recombinant Mouse Areg protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Schwannoma-derived growth factor
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
100-191aa
Target Protein Sequence
VIKPKKNKTEGEKSTEKPKRKKKGGKNGKGRRNKKKKNPCTAKFQNFCIHGECRYIENLEVVTCNCHQDYFGERCGEKSMKTHSEDDKDLSK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.5 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Gene References into Functions
  1. Amphiregulin plays an important role in promoting cardiac fibrosis after myocardial infarction partly though activating the EGFR pathway. PMID: 29349588
  2. The studies indicate that HIF2-alpha induces myocardial AREG expression in cardiac myocytes, which increases myocardial ischemia tolerance. PMID: 29483579
  3. Areg transgenic mice showed less adipose tissue mass with increased mRNA expression levels of Tnf-alpha and peroxisome proliferator-activated receptor gamma coactivator 1 alpha and delayed white adipose tissue development during the convalescent stage in a dextran sodium sulfate-induced colitis model. PMID: 29341420
  4. Regulatory T-cell-intrinsic amphiregulin is dispensable for suppressive function. PMID: 27040371
  5. activated alveolar macrophages also exerted a protective effect on the lung tissues by producing high-level amphiregulin in lipopolysaccharide-induced acute lung injury PMID: 26808632
  6. AREG overexpression in osteoblasts induces a transient high bone mass phenotype in the trabecular compartment of the appendicular skeleton by a growth-related, non-cell autonomous mechanism PMID: 26103093
  7. AREG-silenced keratinocytes plays an important role in regulation cell proliferation. PMID: 26802239
  8. Hepatic CD206-positive macrophages express amphiregulin to promote the immunosuppressive activity of regulatory T cells in HBV infection. PMID: 26216935
  9. Areg may have a role in classically activated macrophages PMID: 26365345
  10. After activation with IL-33, expression of AREG is a dominant functional signature of gut-associated IL-33-dependent group 2 innate lymphoid cells. The frequency and number of AREG-expressing ILC2s increases following intestinal injury. PMID: 26243875
  11. AR induces hHSC fibrogenic activity via multiple mitogenic signaling pathways, and is upregulated in murine and human NASH, suggesting that AR antagonists may be clinically useful anti-fibrotics in NAFLD. PMID: 25744849
  12. hormones and/or factors in addition to E that upregulate AREG can promote mammary gland development and have the potential to affect breast cancer risk associated with pubertal mammary gland development PMID: 23705924
  13. Our data show that AREG is essential for ultraviolet therapy-induced contact hypersensitivity suppression. PMID: 25089660
  14. Pre-maturation with cAMP modulators in conjunction with EGF-like peptides during in vitro maturation enhances mouse oocyte developmental competence. PMID: 24488930
  15. During high-pressure ventilation, Nrf2 becomes activated and induces AREG, leading to a positive feedback loop between Nrf2 and AREG, which involves the p38 MAPK and results in the expression of cytoprotective genes. PMID: 24921206
  16. AREG plays pro-neoplastic roles in colorectal carcinogenesis PMID: 23263765
  17. Amphiregulin expression is regulated by the androgen/androgen receptor pathway. PMID: 23415714
  18. Amphiregulin enhances regulatory T cell-suppressive function via the epidermal growth factor receptor. PMID: 23333074
  19. Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferation PMID: 22570239
  20. AR, or AR-activated EGFR signaling, is a potential therapeutic target for idiopathic pulmonary fibrosis associated with TGF-beta1 activation. PMID: 23086930
  21. The data showed that STAT6 regulated Alternaria-induced lung natrual-helper-cell proliferation and expression of amphiregulin. PMID: 22865552
  22. data demonstrate that AREG-dependent EGFR signaling in airway epithelial cells contributes to MCM in naphthalene-induced lung injury. We conclude that AREG may represent a determinant of nonallergic chronic lung diseases complicated by MCM PMID: 22493011
  23. Lung tumor-associated dendritic cell-derived amphiregulin increased cancer progression. PMID: 21742971
  24. This study implicates that EREG mediates signals downstream of Areg mRNA expression and that EGFR-ERBB2 signals contributes to regulation of ovulation process. PMID: 21237132
  25. A TLR-->MyD88-->AREG/EREG-->EGFR signaling pathway is represented in nonhematopoietic cells of the intestinal tract, responds to microbial stimuli once barriers are breached, and mediates protection against dextran sulfate sodium-induced colitis. PMID: 21041656
  26. ATP released from tumor cells might exert a tumorigenic action by stimulating the secretion of AREG from dendritic cells. PMID: 20651071
  27. is not essential for induction of acute airway inflammation PMID: 20414053
  28. AREG plays a critical role in testinal epithelial growth. PMID: 20534719
  29. Treatment of granulosa cells with forskolin to mimic the effects of LH increases AREG promoter activity in a RIP140-dependent manner. PMID: 20308529
  30. Results describe the role of amphiregulin in an experimental model of bleomycin-induced pneumopathy in mice. PMID: 19915156
  31. Data show that Dmp1 directly bound to the genomic loci of Areg, Tsp-1, JunB and Egr1. PMID: 19816943
  32. These data demonstrate AREG mediates the function of a subset of mammary progenitor cells in vitro. PMID: 19913532
  33. identified amphiregulin as a key regulator of hepatic acute-phase protein gene expression during inflammation and liver regeneration PMID: 19815304
  34. Amphiregulin is a mitogen for adult neural stem cells. PMID: 12205669
  35. amphiregulin binds to EGF receptor and has a role in stimulation of lung epithelial cells upon exposure to tobacco smoke PMID: 12711607
  36. epidermal growth factor (EGF) family members amphiregulin, epiregulin, and beta-cellulin are paracrine mediators that propagate the LH signal throughout the ovulatory follicle PMID: 14726596
  37. Castration leads to adaptive increase in the concentrations of a subset of growth factors from the EGF network in the androgen sensitive CWR22 prostate cancer xenograft. PMID: 15651060
  38. amphiregulin is a protective factor induced in response to liver damage PMID: 15753092
  39. ADAM17 plays a crucial role in mammary morphogenesis by releasing amphiregulin from mammary epithelial cells PMID: 16079154
  40. findings show that T helper 2 (TH2) cells express amphiregulin; expression of amphiregulin by TH2 cells provides a newly recognized link between type 2 adaptive immune response & proliferation of gut epithelial cells that aids helminth parasite removal PMID: 17170297
  41. amphiregulin is an important paracrine mediator of estrogen function specifically required for puberty-induced ductal elongation, but not for any earlier or later developmental stages PMID: 17369357
  42. The absence of amphiregulin promoted the rapid emergence of spasmolytic polypeptide-expressing metaplasia in response to oxyntic atrophy. PMID: 17484876
  43. Amphiregulin plays a specific role in liver fibrosis. Amphiregulin may contribute to the expression of fibrogenic mediators, as well as to the growth and survival of fibrogenic cells. PMID: 18634036
  44. findings identify Amphiregulin as a factor for resistance of glioma cells to delta9-Tetrahydrocannabinol induced apoptosis PMID: 19229996
  45. AR-/- mice develop spasmolytic polypeptide expression metaplasia, which gives rise to goblet cell intestinal metaplasia and invasive fundic dysplastic lesions. PMID: 19230855
  46. Data observed that the expression of amphiregulin, betacellulin and epiregulin was significantly increased in young erythropoietic protoporphyria mice when compared to aged-matched controls in all genetic backgrounds. PMID: 19267999
  47. EGFR ligands (including AREG) are protective in acute lung injury and increase more in mice deficient in Mt1/2 PMID: 16166738

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein.
Protein Families
Amphiregulin family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*