Recombinant Mouse Apolipoprotein C-III (Apoc3)

In Stock
Code CSB-EP001933MO
Abbreviation Recombinant Mouse Apoc3 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Apoc3Apolipoprotein C-III; Apo-CIII; ApoC-III; Apolipoprotein C3
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-99aa
Target Protein Sequence
EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 21-99 constitute the expression domain of recombinant Mouse Apoc3. The expected molecular weight for the Apoc3 protein is calculated to be 24.9 kDa. This Apoc3 protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of Apoc3, making it easier to detect and purify the Apoc3 recombinant protein in the later stages of expression and purification.

Apolipoprotein C-III (ApoC3) is a crucial protein involved in lipid metabolism, and its research covers various fields. In lipid metabolism studies, ApoC3 is extensively examined for its regulatory role in cholesterol and triglyceride metabolism. Particularly, ApoC3 is considered a significant factor in lipid disorders and cardiovascular diseases, drawing attention for its association with conditions like hypercholesterolemia and atherosclerosis. Recent studies also indicate that ApoC3 plays a critical role in metabolic diseases such as diabetes and non-alcoholic fatty liver disease. Furthermore, the link between ApoC3 and metabolic disturbances like obesity and insulin resistance has become a hot topic of research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma. Plays a multifaceted role in triglyceride homeostasis. Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors. Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners.
Gene References into Functions
  1. Both triglyceride-rich lipoproteins (TRLs) and ApoCIII contribute to the progression of atherosclerosis, and the modulation of TRLs and ApoCIII may represent a novel therapeutic approach against hypertriglyceridemia induced atherosclerosis. PMID: 30223835
  2. C3(QK) variant is a gain-of-function mutation that can stimulate VLDL1 production, through enhanced DNL PMID: 28887372
  3. intestinal apoC-III overexpression results in the secretion of smaller, less dense chylomicron particles along with reduced triacylglycerol secretion from the intestine PMID: 28159868
  4. ApoC-III inhibits turnover of TG-rich lipoproteins primarily through a hepatic clearance mechanism mediated by the LDLR/LRP1 axis PMID: 27400128
  5. These data strongly suggest that intestinal apoC-III is not a FoxO1 target and support the idea that apoC-III is not regulated coordinately with hepatic apoC-III, and establishes another key aspect of apoC-III that is unique in the intestine from the liver. PMID: 28739253
  6. APOC3, whose dysregulation is liable for hypertriglyceridemia, is not a predisposing factor for linking overnutrition to NAFLD in obesity PMID: 28115523
  7. Severe hypertriglyceridaemia resulting from ApoCIII overexpression promotes restenosis and atherosclerosis PMID: 26160324
  8. Under conditions of islet insulin resistance, locally produced apoCIII is an important diabetogenic factor involved in impairment of beta-cell function. PMID: 25941406
  9. decreased ApoAI synthesis might be accounted for the lower plasma HDL level in ApoCIII transgenic mice PMID: 25969427
  10. ApoCIII hyperactivates beta cell CaV1 channels through SR-BI/beta1 integrin-dependent coactivation of PKA and Src. PMID: 23949443
  11. Increased plasma APOC3 concentrations predispose mice to diet-induced nonalcoholic fatty liver and hepatic insulin resistance. PMID: 21793029
  12. Glucose induces apoCIII transcription, which may represent a mechanism linking hyperglycemia, hypertriglyceridemia, and cardiovascular disease in type 2 diabetes. PMID: 21183731
  13. PGC-1beta regulates plasma triglyceride metabolism through stimulating apolipoprotein C3 (APOC3) expression and elevating APOC3 levels in circulation PMID: 20889132
  14. The apoC-III metabolism may contribute to dyslipidemia in CKD, and this requires further investigation. PMID: 19542564
  15. Association between SstI polymorphism of the gene, glucose intolerance and cardiovascular risk in renal transplant recipients PMID: 11959336
  16. ApoB lipoproteins that contain apoCIII increase THP-1 cell adhesion to ECs via PKCalpha and RhoA-mediated beta1-integrin activation. PMID: 16461842
  17. oxidized fatty acids may act through an APOA5/APOClll mechanism that contributes to lowering of TG levels other than PPAR* induction PMID: 18243209
  18. the apoCIII enhancer contributes to the maintenance of an active chromatin subdomain of the apoAI/CIII/AIV genes, but not apoAV PMID: 18678879
  19. These results suggest that apoC-III may play a specific role in lipid storage and mobilization in adipocytes, non-lipoprotein-secreting cells, and indicate the functional role of RXRalpha during adipocyte differentiation. PMID: 19121312

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Apolipoprotein C3 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*