Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Apoc3Apolipoprotein C-III; Apo-CIII; ApoC-III; Apolipoprotein C3
Species
Mus musculus (Mouse)
Expression Region
21-99aa
Target Protein Sequence
EEVEGSLLLGSVQGYMEQASKTVQDALSSVQESDIAVVARGWMDNHFRFLKGYWSKFTDKFTGFWDSNPEDQPTPAIES
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 21-99 constitute the expression domain of recombinant Mouse Apoc3. The expected molecular weight for the Apoc3 protein is calculated to be 24.9 kDa. This Apoc3 protein is produced using e.coli expression system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of Apoc3, making it easier to detect and purify the Apoc3 recombinant protein in the later stages of expression and purification.
Apolipoprotein C-III (ApoC3) is a crucial protein involved in lipid metabolism, and its research covers various fields. In lipid metabolism studies, ApoC3 is extensively examined for its regulatory role in cholesterol and triglyceride metabolism. Particularly, ApoC3 is considered a significant factor in lipid disorders and cardiovascular diseases, drawing attention for its association with conditions like hypercholesterolemia and atherosclerosis. Recent studies also indicate that ApoC3 plays a critical role in metabolic diseases such as diabetes and non-alcoholic fatty liver disease. Furthermore, the link between ApoC3 and metabolic disturbances like obesity and insulin resistance has become a hot topic of research.