Recombinant Mouse Arginase-1 (Arg1)

In Stock
Code CSB-EP733775MO
Abbreviation Recombinant Mouse Arg1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP733775MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Arg1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP733775MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Arg1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Arg1
Uniprot No.
Research Area
Others
Alternative Names
Arg1Arginase-1; EC 3.5.3.1; Liver-type arginase; Type I arginase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-323aa
Target Protein Sequence
MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
50.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Key element of the urea cycle converting L-arginine to urea and L-ornithine, which is further metabolized into metabolites proline and polyamides that drive collagen synthesis and bioenergetic pathways critical for cell proliferation, respectively; the urea cycle takes place primarily in the liver and, to a lesser extent, in the kidneys.; Functions in L-arginine homeostasis in nonhepatic tissues characterized by the competition between nitric oxide synthase (NOS) and arginase for the available intracellular substrate arginine. Arginine metabolism is a critical regulator of innate and adaptive immune responses. Involved in an antimicrobial effector pathway in polymorphonuclear granulocytes (PMN). Upon PMN cell death is liberated from the phagolysosome and depletes arginine in the microenvironment leading to suppressed T cell and natural killer (NK) cell proliferation and cytokine secretion. In group 2 innate lymphoid cells (ILC2s) promotes acute type 2 inflammation in the lung and is involved in optimal ILC2 proliferation but not survival. Plays a role in the immune response of alternatively activated or M2 macrophages in processes such as wound healing and tissue regeneration, immune defense against multicellular pathogens and parasites, and immune suppression and allergic inflammation; the regulatory outcome seems to be organ specific. In tumor-infiltrating dendritic cells (DCs) and myeloid-derived suppressor cells (MDSCs) plays a role in suppression of T cell-mediated antitumor immunity.
Gene References into Functions
  1. Our studies provide proof-of-concept for gene-editing at the Arg1 locus and highlight the challenges that lie ahead to restore sufficient liver-based urea cycle function in patients with urea cycle disorders. PMID: 28566761
  2. This study shows for the first time that diabetes-induced increases in arginase 1 expression promotes endothelial cell senescence through the activation of p16INK4A and p53 signaling pathways. PMID: 29673160
  3. findings identified a novel function of the VEGFR1 signaling in avoiding over-expression of Arginase 1 potentially to maintain the proper innate immune response. PMID: 29110610
  4. Up-regulation of arginase 1 expression/activity in vascular endothelial cells has an integral role in diet-induced cardiovascular dysfunction and metabolic syndrome. PMID: 29048462
  5. Complete ablation of Arg1 in the lung affects mRNA abundance of arginine-transporting and -metabolizing genes, and pro-inflammatory genes, but not methacholine responsiveness or accumulation of inflammatory cells. PMID: 29183288
  6. Data suggest that Arg1 mRNA and protein expression in liver are significantly higher in obese mice (fed high-fat diet) than in control mice; hepatic Arg1 levels positively correlate with plasma Arg1 levels and negatively correlate with L-arginine bioavailability in plasma. Increased expression of hepatic Arg1 and reduced plasma L-arginine and NO(2)(-) may lead to vascular endothelial dysfunction even in early obesity. PMID: 29098611
  7. Data suggest that chronic hypoxia enhances HIF-2alpha stability, which causes increased arginase expression and dysregulates normal vascular NO homeostasis. PMID: 27432976
  8. high-fat/high-sucrose diet-induced visceral adipose tissue inflammation is mediated by endothelial cells-A1 expression/activity. PMID: 28835451
  9. Deletion of Arg1 in hematopoietic cells adversely affects blood leukocyte counts and increases foam cell formation. However, no effects on atherosclerosis could be demonstrated, indicating that hematopoietic Arg1 function is not a decisive factor in atherosclerotic plaque formation. PMID: 27998825
  10. diabetes-dependent increase in renal arginase-2 expression also requires arginase-1 expression in macrophages PMID: 28446459
  11. this study shows that mice lacking Arg1 in macrophages develop increased allergic contact hypersensitivity PMID: 28747341
  12. this study shows that Ron is expressed in a subpopulation of macrophages during chronic inflammation induced by obesity that exhibit a repair phenotype as determined by the expression of arginase 1 PMID: 27233965
  13. Arginase 1 was highly expressed by tumor-associated Gr1+ microglia and macrophages. PMID: 27936099
  14. This study uncovers synergistic activation of Arg1 by retinoic acid and IL-4 in M2 macrophages. PMID: 27166374
  15. this study shows that group 2 innate lymphoid cells selectively express arginase 1 and that this is critical for their bioenergetics, proliferation and function PMID: 27043409
  16. this study shows that c-Jun regulates the activation state of macrophages and promotes arthritis via differentially regulating cyclooxygenase-2 and arginase-1 levels PMID: 28298526
  17. deletion or TNF-mediated restriction of Arg1 unleashes the production of nitric oxide by NOS2, which is critical for pathogen control. PMID: 27117406
  18. Data indicate that transfected mouse arginase-1 (Arg-I) promotes endothelial senescence and inflammatory responses through eNOS-uncoupling in human umbilical vein endothelial cells (HUVEC cells). PMID: 28153047
  19. Arg1 is down-regulated during osteoclast differentiation and may negatively regulate osteoclast differentiation by regulating nitric oxide production. PMID: 26475291
  20. Results show that arginase 1 is abundantly present in the bone and bone marrow stromal cells and reveal the role of its deregulation in diabetes-induced bone complications. * HFHS diet induced Arginase activity and expression in bone and bone marrow. PMID: 26704078
  21. T Lymphocyte Inhibition by Tumor-Infiltrating Dendritic Cells Involves Ectonucleotidase CD39 but Not Arginase-1. PMID: 26491691
  22. The production of arginase-1 by tumor cells leads to an ineffective anti-tumor immune response. PMID: 24614600
  23. Arg1+ microglia are involved in Abeta plaque reduction during sustained, IL-1beta-dependent neuroinflammation PMID: 26538310
  24. findings suggest that increased IL-17A expression by macrophages in E7-expressing skin exposed to DNCB promotes arginase-1 induction and contributes directly to the observed hyperinflammation. PMID: 25720383
  25. Arginase 1 is crucially involved in Ang II-induced smooth muscle cell proliferation and arterial fibrosis and stiffness and represents a promising therapeutic target. PMID: 25807386
  26. FoxO4 activates Arg1 transcription in endothelial cells in response to MI, leading to downregulation of nitric oxide and upregulation of neutrophil infiltration to the infarct area. PMID: 26438688
  27. TAT fused to WW2/WW3 of Smurf2 could interfere with TGF-beta signaling and reduce ArgI gene expression. PMID: 25612247
  28. ARG1 activity may participate in the pathogenesis of lymphoproliferative and myeloproliferative disorders. PMID: 26363032
  29. data indicate that helminth coinfection induces arginase-1-expressing type 2 granulomas, thereby increasing inflammation and TB disease severity. PMID: 26571397
  30. Flow cytometric analysis of intrasplenic leukocytes exposed the presence of a transient population of activated neutrophils that correlated quantitatively with elevated ArgI levels in culture media PMID: 25966956
  31. Arginase 1 activity worsens lung-protective immunity against Streptococcus pneumoniae infection. PMID: 25789453
  32. Arg1 expression is decreased, and Arg2 expression is increased in the newborn congenital obstructive nephropathy and in the mouse model. PMID: 25205225
  33. Promoter region methylation was decreased at Arg1 in THC-induced myeloid-derived suppressor cells, which then expressed higher Arg1 levels. PMID: 25713087
  34. Arg1 plays a central role in the control of TB when NOS2 is rendered ineffective by hypoxia. PMID: 25201986
  35. arginase I activity is required for M2 macrophages mediated protection during DSS-induced colitis in PI3Kp110delta-deficient mice. PMID: 25124254
  36. the cross talk between HDAC4 and STAT6 is an important regulatory mechanism of Arg1 transcription in dendritic cells PMID: 25332236
  37. Diabetic mice exhibit elevated vascular Arg1 and impaired vascular endothelial and nitrergic function. PMID: 23977269
  38. A myeloid cell uptake of damaged retinal pigment epithelium or its derivatives as a mechanism generating VEGF (+) Arg-1(+) phenotype in vivo, is demonstrated. PMID: 23977372
  39. Our results demonstrate that HPV16.E7 protein enhances drug associated production of arginase-1 by myeloid cells and consequent inflammatory cellular infiltration of skin. PMID: 24732401
  40. Reduced arginase-1 activity in Arg1(fl/fl)/Tie2-Cre(tg/-) mice resulted in increased inflammatory response and nitric oxide production by NOS2. PMID: 24465919
  41. these data support the notion that PTEN contributes to cell fate decisions of macrophages exemplified by increased Arginase I expression. PMID: 25015834
  42. tumor myeloid cells inhibit the adaptive immune response after radiation therapy through expression of the enzyme arginase I PMID: 24992164
  43. neither induction of alternative activation nor expression of arginase1 are critical features of disease mediated by attenuated or virulent Francisella species. PMID: 24324751
  44. A kinesin heavy chain released by T. brucei induces IL-10 and arginase-1 through SIGN-R1 signaling in myeloid cells, which promotes early trypanosome growth and favors parasite settlement in the host. PMID: 24204274
  45. ATRA enhances both Arg-1 and iNOS expression in IFN-gamma-treated DCs, resulting in a tolerogenic phenotype. PMID: 24790153
  46. Murine primary macrophages treated with HDL showed increased gene expression for the M2 markers Arginase-1 (Arg-1) and Fizz-1 PMID: 23991225
  47. ILC2s are a novel source of Arg1 in resting tissue and during allergic inflammation. PMID: 23924659
  48. In preclinical murine models reduced Arg expression directly correlates with delayed healing of skin wounds. PMID: 23552798
  49. Our objective was to elucidate mechanisms involved in modulating arginase I induction by IL-4 in murine M2 macrophages PMID: 23913966
  50. wall shear stress is a key biomechanical regulator of arginase during atherosclerotic plaque formation and stability PMID: 23390893

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasmic granule.
Protein Families
Arginase family
Tissue Specificity
Expressed in macrophages. Expressed in precursor and mature group 2 innate lymphoid cells (ILC2s). Expressed in lung tumor-associated myeloid cells. Expressed in lung tumor-infiltrating dendritic cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*