Recombinant Mouse Basic leucine zipper transcriptional factor ATF-like (Batf)

In Stock
Code CSB-EP002570MO
Abbreviation Recombinant Mouse Batf protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Batf
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-125aa
Target Protein Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLSSHEPLCSVLASGTPSPPEVVYSAHAFHQPHISSPRFQP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
AP-1 family transcription factor that controls the differentiation of lineage-specific cells in the immune system: specifically mediates the differentiation of T-helper 17 cells (Th17), follicular T-helper cells (TfH), CD8(+) dendritic cells and class-switch recombination (CSR) in B-cells. Acts via the formation of a heterodimer with JUNB that recognizes and binds DNA sequence 5'-TGA[CG]TCA-3'. The BATF-JUNB heterodimer also forms a complex with IRF4 (or IRF8) in immune cells, leading to recognition of AICE sequence (5'-TGAnTCA/GAAA-3'), an immune-specific regulatory element, followed by cooperative binding of BATF and IRF4 (or IRF8) and activation of genes. Controls differentiation of T-helper cells producing interleukin-17 (Th17 cells) by binding to Th17-associated gene promoters: regulates expression of the transcription factor RORC itself and RORC target genes such as IL17 (IL17A or IL17B). Also involved in differentiation of follicular T-helper cells (TfH) by directing expression of BCL6 and MAF. In B-cells, involved in class-switch recombination (CSR) by controlling the expression of both AICDA and of germline transcripts of the intervening heavy-chain region and constant heavy-chain region (I(H)-C(H)). Following infection, can participate in CD8(+) dendritic cell differentiation via interaction with IRF4 and IRF8 to mediate cooperative gene activation. Regulates effector CD8(+) T-cell differentiation by regulating expression of SIRT1. Following DNA damage, part of a differentiation checkpoint that limits self-renewal of hematopoietic stem cells (HSCs): up-regulated by STAT3, leading to differentiation of HSCs, thereby restricting self-renewal of HSCs.
Gene References into Functions
  1. BATF plays a key role in the differentiation of T helper cell subsets and Ig class-switching. Apart from that we suggest an important function in mast cell development and in murine models of allergic asthma, it was observed that mice deficient for Batf are protected from the disease. Hence, the previous findings on BATF make it an interesting target for the treatment of Th cell-derived-cytokine-driven diseases. PMID: 26970726
  2. repressed BATF expression contributes to impaired Treg functions caused by A384T mutation in Foxp3 PMID: 28778586
  3. these findings reveal BATF as a central modulator of peripheral and humoral hallmarks of type-2 immunity and begin to elucidate a novel mechanism by which it regulates type-2 cytokine production through its modification of the Th2 locus control region. PMID: 27798167
  4. Our studies uncovered the critical role of two transcription factors, IRF1 and BATF, in preparing the chromatin landscape for induction of the Tr1 gene network in response to IL-27 signaling, where BATF acted as a pioneer factor and prepared the genomic landscape for the binding of additional transcription factors that define the Tr1 lineage. PMID: 28166218
  5. BATF/JUN-B and BATF/C-JUN complexes play important roles in OA cartilage destruction through regulating anabolic and catabolic gene expression in chondrocytes. PMID: 27147707
  6. this study shows that the affinity of different enhancers for the BATF-IRF4 complex might underlie divergent signaling outcomes in response to various strengths of TCR signaling PMID: 28346410
  7. BATF overexpression sufficiently rescues "unhelped" CD8 T cells. BATF and IRF4 cooperatively regulate Blimp-1 expression and effector T cell function . PMID: 26527008
  8. These results indicate a positive role of Batf in promoting the generation of pro-allergic IL-4-producing T-follicular helper cells. PMID: 26278622
  9. The transcription factors IRF4 and BATF are major regulators of antiviral cytotoxic T-cell immunity. PMID: 24531538
  10. BATF is essential for initial commitment of naive T8 cells to effector development but becomes dispensable by 72h. This makes possible a study of gene function in vivo in unperturbed cells of hematopoietic origin that are refractory to viral transduction. PMID: 25548173
  11. amplifies CD8+ T cell TCR-dependent expression of transcription factors and inflammatory signals but restrains the expression of effector molecules PMID: 24584090
  12. knock-out mice have reduced pathophysiologic signs of asthma, decreased IL-3 production and mast cells development PMID: 24290279
  13. The activator protein 1 (AP1) family transcription factor BATF (B cell, activating transcription factor-like) was among the genes enriched in Th9 cells and was required for the expression of IL-9 and other Th9-associated genes. PMID: 24216482
  14. BATF joins RORgammat as the molecular signature for all IL-17 producing cells in vivo. PMID: 23537103
  15. A previously unknown function of early growth response gene (Egr)-2 in the control of T helper (Th)17 cytokine expression and Th17 differentiation by inhibition of Batf function. PMID: 23203924
  16. BATF-JUN family protein complexes cooperate with IRF4 in binding to AP1-IRF composite elements in pre-activated CD4( ) T cells stimulated with IL-21 and in T(H)17 differentiated cells PMID: 22992523
  17. Compensation among BATF factors is based on the shared capacity of their leucine zipper domains to interact with non-AP1 factors such as IRF4 and IRF8 to mediate cooperative gene activation. PMID: 22992524
  18. BATF, together with c-Jun, transcriptionally inhibited expression of the nicotinamide adenine dinucleotide (NAD(+))-dependent deacetylase Sirt1 PMID: 21873234
  19. Data show that BATF functions at multiple hierarchical levels in two cell types to globally regulate switched antibody responses in vivo. PMID: 21572431
  20. Batf mediates the differentiation-inducing effects of Stat3 signaling in M1 cells and suggest that Batf may play a similar role in other blood cell lineages where alterations to the Jak-Stat pathway are hallmarks of disrupted development and disease. PMID: 21296860
  21. PD-1 inhibits T cell function by upregulating BATF. PMID: 20890291
  22. Loss of Batf disrupts multiple components of the lymphocyte communication network that are required for a robust immune response. PMID: 20421391
  23. This study revealed that older BAFF transgenic mice exhibit an anxiety-like phenotype associated with brain inflammation. PMID: 20185032
  24. Stat3 mediates cellular growth by modulating AP-1 activity through the induction of BATF PMID: 12444555
  25. Fos/Jdp2/Batf locus is associated with SL3-3 mouse leukemia virus B cell lymphoma. PMID: 15913695
  26. results demonstrate that the AP-1 protein BATF has a critical role in T(H)17 differentiation PMID: 19578362

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Present in the nucleus and cytoplasm, but shows increased nuclear translocation after activation of T-cells.
Protein Families
BZIP family
Tissue Specificity
Detected in postnatal and adult lymphoid tissues such as thymus, spleen and lymph nodes. In thymus most concentrated expression is found in the immediate cortical layer. Differentially expressed during T-cell development in thymus. Highly expressed in Th1
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*