Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Defb1

Uniprot No.

P56386

Research Area

Others

Alternative Names

Defb1Beta-defensin 1; BD-1; mBD-1; Defensin; beta 1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

33-69aa

Target Protein Sequence

DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.1kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Mouse Defb1 covers amino acids 33-69. This Defb1 protein is theoretically predicted to have a molecular weight of 20.1 kDa. This Defb1 recombinant protein is manufactured in e.coli. The Defb1 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Defb1 protein during the following stages.

Mouse beta-defensin 1 (Defb1) is a member of the beta-defensin family, which are small cationic peptides with antimicrobial properties. Defb1 is expressed in various tissues, including the skin, respiratory tract, and reproductive organs, serving as a component of the innate immune system. Its main function is to protect against microbial infections by disrupting the cell membranes of bacteria, fungi, and viruses. Additionally, Defb1 has been implicated in immune modulation and wound healing processes. Research areas related to Defb1 include investigations into its role in host-pathogen interactions, its contribution to mucosal immunity, and its potential therapeutic applications in combating infectious diseases. Understanding Defb1 enhances our knowledge of innate immune defense mechanisms.

Target Background

Function

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.

Gene References into Functions

Fenofibrate and gemfibrozil inhibit LPS-induced inflammatory activation of macrophages via PPARalpha/beta-defensin 1/TLR4 pathway. PMID: 25881202
these studies demonstrate a role for the murine beta-defensin 1 peptide in early control of Candida infection in a murine model of mucosal candidiasis PMID: 25595775
Akt1 is involved in the regulation of defensin expression and the innate immune response important for bacterial clearance PMID: 21559496
Histopathology showed a greater inflammatory influx in the lungs of mBD-1((-/-)) mice at Day 3 postinfection compared with WT C57BL/6 mice PMID: 21551252
The decreased production of antimicrobial peptides by burn-site epidermal keratinocytes influenced by Gr-1(+)CD11b(+) cells was shown to be restored by glycyrrhizin. PMID: 19843573
elimination of mBD-1 results in a defect in the ability of the host to clear H. influenzae from the lung, which is most consistent with this peptide functioning as an antibiotic at the airway surface. PMID: 12010999
Murine beta-defensins-1 and -4 were present in newborn skin. PMID: 12612195
The expression of BD1 was significantly elevated in the lungs of cigarette smoke-exposed mice compared with air-exposed mice. PMID: 18699806
Although both murine beta-defensin (mBD)-1 and mBD2 are constitutively expressed in normal BALB/c and C57BL/6 corneas, mBD-1 is not required for host resistance against Pseudomonas aeruginosa-induced corneal infection. PMID: 19155510

Hide All

Subcellular Location

Secreted. Membrane.

Protein Families

Beta-defensin family

Tissue Specificity

Detected in kidney.

Database Links

KEGG: mmu:13214

STRING: 10090.ENSMUSP00000051754

UniGene: Mm.431316

Code	CSB-EP006662MO
Abbreviation	Recombinant Mouse Defb1 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Beta-defensin 1 (Defb1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage