Recombinant Mouse Beta-defensin 1 (Defb1)

In Stock
Code CSB-EP006662MO
Abbreviation Recombinant Mouse Defb1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Defb1
Uniprot No.
Research Area
Others
Alternative Names
Defb1Beta-defensin 1; BD-1; mBD-1; Defensin; beta 1
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
33-69aa
Target Protein Sequence
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.1kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Mouse Defb1 covers amino acids 33-69. This Defb1 protein is theoretically predicted to have a molecular weight of 20.1 kDa. This Defb1 recombinant protein is manufactured in e.coli. The Defb1 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Defb1 protein during the following stages.

Mouse beta-defensin 1 (Defb1) is a member of the beta-defensin family, which are small cationic peptides with antimicrobial properties. Defb1 is expressed in various tissues, including the skin, respiratory tract, and reproductive organs, serving as a component of the innate immune system. Its main function is to protect against microbial infections by disrupting the cell membranes of bacteria, fungi, and viruses. Additionally, Defb1 has been implicated in immune modulation and wound healing processes. Research areas related to Defb1 include investigations into its role in host-pathogen interactions, its contribution to mucosal immunity, and its potential therapeutic applications in combating infectious diseases. Understanding Defb1 enhances our knowledge of innate immune defense mechanisms.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Gene References into Functions
  1. Fenofibrate and gemfibrozil inhibit LPS-induced inflammatory activation of macrophages via PPARalpha/beta-defensin 1/TLR4 pathway. PMID: 25881202
  2. these studies demonstrate a role for the murine beta-defensin 1 peptide in early control of Candida infection in a murine model of mucosal candidiasis PMID: 25595775
  3. Akt1 is involved in the regulation of defensin expression and the innate immune response important for bacterial clearance PMID: 21559496
  4. Histopathology showed a greater inflammatory influx in the lungs of mBD-1((-/-)) mice at Day 3 postinfection compared with WT C57BL/6 mice PMID: 21551252
  5. The decreased production of antimicrobial peptides by burn-site epidermal keratinocytes influenced by Gr-1(+)CD11b(+) cells was shown to be restored by glycyrrhizin. PMID: 19843573
  6. elimination of mBD-1 results in a defect in the ability of the host to clear H. influenzae from the lung, which is most consistent with this peptide functioning as an antibiotic at the airway surface. PMID: 12010999
  7. Murine beta-defensins-1 and -4 were present in newborn skin. PMID: 12612195
  8. The expression of BD1 was significantly elevated in the lungs of cigarette smoke-exposed mice compared with air-exposed mice. PMID: 18699806
  9. Although both murine beta-defensin (mBD)-1 and mBD2 are constitutively expressed in normal BALB/c and C57BL/6 corneas, mBD-1 is not required for host resistance against Pseudomonas aeruginosa-induced corneal infection. PMID: 19155510

Show More

Hide All

Subcellular Location
Secreted. Membrane.
Protein Families
Beta-defensin family
Tissue Specificity
Detected in kidney.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*