Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Defb1Beta-defensin 1; BD-1; mBD-1; Defensin; beta 1
Species
Mus musculus (Mouse)
Expression Region
33-69aa
Target Protein Sequence
DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Mouse Defb1 covers amino acids 33-69. This Defb1 protein is theoretically predicted to have a molecular weight of 20.1 kDa. This Defb1 recombinant protein is manufactured in e.coli. The Defb1 gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Defb1 protein during the following stages.
Mouse beta-defensin 1 (Defb1) is a member of the beta-defensin family, which are small cationic peptides with antimicrobial properties. Defb1 is expressed in various tissues, including the skin, respiratory tract, and reproductive organs, serving as a component of the innate immune system. Its main function is to protect against microbial infections by disrupting the cell membranes of bacteria, fungi, and viruses. Additionally, Defb1 has been implicated in immune modulation and wound healing processes. Research areas related to Defb1 include investigations into its role in host-pathogen interactions, its contribution to mucosal immunity, and its potential therapeutic applications in combating infectious diseases. Understanding Defb1 enhances our knowledge of innate immune defense mechanisms.
