Recombinant Mouse Calcium-dependent phospholipase A2 (Pla2g5)

In Stock
Code CSB-EP018103MO
Abbreviation Recombinant Mouse Pla2g5 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Pla2g5; Calcium-dependent phospholipase A2; EC 3.1.1.4; Group V phospholipase A2; PLA2-10; Phosphatidylcholine 2-acylhydrolase 5
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
21-137aa
Target Protein Sequence
GLLELKSMIEKVTGKNAFKNYGFYGCYCGWGGRGTPKDGTDWCCQMHDRCYGQLEEKDCAIRTQSYDYRYTNGLVICEHDSFCPMRLCACDRKLVYCLRRNLWTYNPLYQYYPNFLC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
29.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Mouse Calcium-dependent phospholipase A2 (Pla2g5) recombinant protein was produced in E.coli, where the gene sequence encoding Mouse Pla2g5 (21-137aa) was expressed with the N-terminal 6xHis-SUMO tag. The purity of this Pla2g5 protein was greater than 90% by SDS-PAGE.
Pla2g5 is an enzyme that primarily functions by catalyzing the hydrolysis of phospholipids, producing free fatty acids and soluble phospholipids. This process plays a crucial role in the metabolism of cell membranes, cell signal transduction, and inflammatory responses. Pla2g5 is typically expressed in various tissues and cell types, including the liver, kidneys, gastrointestinal tract, spleen, and white blood cells. Its specific biological roles in the organism include maintaining the integrity of cell membranes, regulating cell signal transduction, and participating in inflammatory responses.
Some members of the Pla2g5 enzyme family have been found to be associated with inflammatory responses and diseases. Pla2g5 may play a role in modulating the inflammatory process, as the reaction it catalyzes leads to the release of phospholipids, triggering cell membrane rupture and lipid-mediated inflammatory responses, among other effects.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secretory calcium-dependent phospholipase A2 that primarily targets extracellular phospholipids. Hydrolyzes the ester bond of the fatty acyl group attached at sn-2 position of phospholipids (phospholipase A2 activity), preferentially releasing fatty acyl groups with a low degree of unsaturation such as oleoyl (C18:1) and linoleoyl (C18:2) groups. Hydrolyzes low-density lipoprotein (LDL) phospholipids releasing unsaturated fatty acids that drive macrophage polarization toward an M2 phenotype. May act in an autocrine and paracrine manner. Contributes to lipid remodeling of cellular membranes at different subcellular locations and generation of lipid mediators involved in pathogen clearance. Cleaves sn-2 fatty acyl chains of cardiolipin, a major component of the inner membrane of mitochondria and bacterial membranes. Promotes phagocytosis of bacteria in macrophages through production of lysophosphatidylethanolamines. Displays bactericidal activity against Gram-positive bacteria by directly hydrolyzing the phospholipids of the bacterial membrane. Promotes phagocytosis and killing of ingested fungi likely through controlling phagosome-lysosome fusion and phagosome maturation. Plays a role in biosynthesis of cysteinyl leukotrienes (CysLTs) in myeloid cells. In eosinophils, triggers perinuclear arachidonate release and LTC4 synthesis in a PLA2G4A-independent way. In neutrophils, amplifies CysLTs biosynthesis initiated by PLA2G4A. Promotes immune complex clearance in macrophages via stimulating synthesis of CysLTs, which act through CYSLTR1 to trigger phagocytosis. May regulate antigen processing in antigen-presenting cells. In pulmonary macrophages regulates IL33 production required for activation of group 2 innate lymphoid cells. May play a role in the biosynthesis of N-acyl ethanolamines that regulate energy metabolism. Hydrolyzes N-acyl phosphatidylethanolamines to N-acyl lysophosphatidylethanolamines, which are further cleaved by a lysophospholipase D to release N-acyl ethanolamines.
Gene References into Functions
  1. macrophage-associated Pla2g5 contributes significantly to type-2 immunity through regulation of IL-33 induction and free fatty acids-driven group 2 innate lymphoid cell activation PMID: 29346348
  2. Deficiency of GV sPLA2 results in diminished glucose-stimulated insulin secretion in isolated pancreatic beta-cells PMID: 28825176
  3. GV sPLA2 is involved in the maintenance of tubular cell function and integrity, promoting sodium retention through increased cortical (Na+ + K+)-ATPase expression and activity. PMID: 26820468
  4. AdPLA2 plays an important role in promoting tumorigenesis and disease progression by modulating the production of prostaglandins and may serve as a potential therapeutic target in TSC and LAM. PMID: 25347447
  5. PLA2G5 hydrolyzed phosphatidylcholine in fat-overladen low-density lipoprotein to release unsaturated fatty acids, which prevented palmitate-induced M1 macrophage polarization. PMID: 24910243
  6. Key Data shows the role of group v secreted phospholipase A2 in Th2 cytokine and dendritic cell-driven airway hyperresponsiveness and remodeling. PMID: 23451035
  7. Our studies identified a unique function of gV-sPLA2 in activation of macrophages PMID: 23650617
  8. The impact of group V sPLA(2) deficiency on angiotensin (Ang) II-induced cardiac fibrosis in apoE deficient mice was investigated. PMID: 22813854
  9. The results indicate that the PLA(2) activity also plays a substantial role in protecting cells against oxidant stress caused by an exogenous hydroperoxide. PMID: 22067043
  10. GV sPLA(2) in bone marrow-derived myeloid cells as well as non-myeloid cells, which are likely bronchial epithelial cells, participate in the regulation of the innate immune response to pulmonary infection with E. coli. PMID: 21849511
  11. Data from cuprizone-induced model of multiple sclerosis suggest that sPLA2 down-regulation during remyelination can limit release of AA and consequent production of pro-inflammatory PGs/TXB2 (which are increased during demyelination). PMID: 21530210
  12. sPLA(2)-V plays an important role in the pathogenesis of myocardial ischemia reperfusion injury partly in concert with the activation of cPLA(2) PMID: 21169294
  13. agonist-induced MAPK activation leads to Prdx6 phosphorylation and translocation to the cell membrane, where its PLA(2) activity facilitates assembly of the NOX2 complex and activation of the oxidase. PMID: 21262967
  14. expression of group V sPLA(2) in antigen-presenting cells regulates Ag processing and maturation of dendritc cells and contributes to pulmonary inflammation and immune response against D. farinae. PMID: 20817863
  15. Demonstrate the role of sPLA(2)-V in lipopolysaccharide-induced ICAM-1 and VCAM-1 protein overexpression and leukocyte recruitment, supporting the contribution of sPLA(2)-V in the development of inflammatory innate immune responses. PMID: 20232296
  16. encapsulation of Group V PLA2 into granules brings the enzyme to the perinuclear envelope during cell activation PMID: 12963740
  17. a role in innate immunity. PMID: 14761945
  18. Group V secretory PLA2 contributes to the innate immune response both through regulation of eicosanoid generation in response to a phagocytic stimulus and also as a component of the phagocytic machinery. PMID: 16407308
  19. group V, but not group X, secreted phospholipase A2 has a role in lung dysfunction PMID: 17008322
  20. Delayed-phase PGD(2) generation and COX-2 induction were reduced approximately 35% in C57BL/6 Pla2g5-/- bone marrow-derived mast cells. PMID: 17064958
  21. In mast cells lacking group V secretory PLA(2), the course of phosphorylation of ERK1/2 and of cPLA(2)alpha was markedly truncated. PMID: 17369491
  22. group v phospholipase A2 is a critical messenger enzyme in the development of airway hyperresponsiveness and regulation of cell migration during immunosensitization by a pathway that is independent of group IVa phospholipase A2 PMID: 17878379
  23. results demonstrate the critical role of cPLA2 for the duration of inflammation in collagen-induced arthritis PMID: 18825749
  24. role for syndecan-4 in mediating the uptake of LDL modified by group V secretory phospholipase A2, a process implicated in atherosclerotic lesion progression PMID: 19056705
  25. sPLA(2), either through pathways comprising Ras/Raf-1/MEK1/ERK1/2 or the classical PKC family, plays an essential role in Mtb-mediated ROS generation and inflammatory mediator release by microglial cells. PMID: 19115385
  26. gVPLA(2) is an inducible protein in pla2g5(+/+) mice but not in pla2g5(-/-) mice within 24 h after lipopolysaccharide treatment PMID: 19286925
  27. group V sPLA(2) regulates phagocytosis through major phagocytic receptors and contributes to the innate immune response against C. albicans by regulating phagocytosis and killing through a mechanism that is likely dependent on phagolysosome fusion PMID: 19342668

Show More

Hide All

Subcellular Location
Secreted. Cell membrane. Cytoplasmic vesicle, phagosome. Recycling endosome. Golgi apparatus, cis-Golgi network. Golgi apparatus, trans-Golgi network.
Protein Families
Phospholipase A2 family
Tissue Specificity
Expressed in peritoneal macrophages (at protein level). Expressed in heart, skeletal muscle and white adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*