Recombinant Mouse Caveolin-3 (Cav3)

Code CSB-MP004573MO
Abbreviation Recombinant Mouse Cav3 protein
MSDS
Size $290
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
M-caveolin
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
1-151aa
Target Protein Sequence
MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKYWCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVCSNIKVVLRREG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.4 kDa
Protein Length
Full Length
Tag Info
N-terminal hFc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity. May also regulate voltage-gated potassium channels. Plays a role in the sarcolemma repair mechanism of both skeletal muscle and cardiomyocytes that permits rapid resealing of membranes disrupted by mechanical stress. Mediates the recruitment of CAVIN2 and CAVIN3 proteins to the caveolae.
Gene References into Functions
  1. Pathogenic p.P104 mutation causes endoplasmic reticulum stress, impairs protein processing, ECM remodeling and sarcolemmal integrity. PMID: 30153853
  2. Cav-3 and Smad3 may be involved in the occurrence and development of viral myocarditis. PMID: 28770956
  3. CAV3 protein has a physiological role in glycometabolism, growth and proliferation, independent of insulin stimulation PMID: 29206848
  4. The Cav3 P104L mutation of limb girdle muscular dystrophy-1C leads to disordered glucose metabolism in muscle cells. PMID: 28232187
  5. Cav-3 overexpressing mice have changes in ECG intervals, heart rates, and cardiac ion channel expression PMID: 27023865
  6. Loss of CAV3 interferes with downstream insulin signaling and lipid uptake and increases susceptibility to palmitate-induced insulin resistance. PMID: 27033451
  7. eNOS, caveolin-3, and connexin-43 were detected in subsarcolemmal mitochondria PMID: 25694588
  8. Data show increased expression of T-type Ca(2+) current and association of protein kinase C alpha (PKCalpha) with caveolin-3 (Cav-3)was disrupted in the hypertrophic ventricular myocyte. PMID: 26170457
  9. Cardioprotection in myocardial infarction is abolished in caveolin-3 knockout mice. PMID: 25912591
  10. The lithogenic diet was associated with significantly lower CAV3 in the liver and lower CAV3 and CCKAR in the gallbladder compared with the control mice. PMID: 25071346
  11. Cav-3 may be a novel participant in B-cell expression, T-cell cytokine production and activation of inflammation PMID: 25476831
  12. Cav3 protein can modify integrin function and mechanotransduction in the cardiomyocyte and intact heart PMID: 25366344
  13. Deinactivation of Cav3 channels increases T-type Ca(2+) influx and increases feedback inhibition in olfactory bulb. PMID: 25319700
  14. Data reveal the membrane cholesterol dependence of normoxic myocardial and coronary function, I/R tolerance, and morphine-mediated cardioprotection in murine hearts (all declining with cholesterol depletion). PMID: 25063791
  15. Cav-3 has a pivotal role in defending cardiomyocytes against the TNF pro-apoptotic action and alpha-linoleic acid has the capacity to regulate this mechanism preventing cardiac degenerative diseases. PMID: 24042018
  16. the distribution of ryanodine receptors (RyRs) and caveolin-3 (CAV3) in mouse ventricular myocytes PMID: 23746531
  17. Palmitate diet-induced loss of cardiac caveolin-3 constitutes a novel mechanism for lipid-induced contractile dysfunction. PMID: 23585895
  18. hyperglycemia-induced PKCbeta2 activation requires caveolae and is associated with reduced Cav-3 expression in the diabetic heart. PMID: 23474486
  19. Data suggest caveolin-1 (but not caveolin 3) is down-regulated in plasma membrane/caveolae/mitochondria in myocardium in acute ischemia-reperfusion injury. PMID: 23403888
  20. Inhibition of MSTN activity by overexpression of cav-3 induces an activation of protein synthesis rather than an inhibition of proteolysis. PMID: 22791505
  21. We show that a TbetaRI kinase inhibitor, Ki26894, restores impaired myoblast differentiation in vitro caused by activin, myostatin, and TGF-beta1, as well as CAV3(P104L). PMID: 22584670
  22. Cav-3 plays an essential role in adiponectin transmembrane signaling and APN anti-ischemic/cardioprotective actions. PMID: 22328772
  23. Findings suggest that the ER stress response caused by mCav3(P104L) plays a role in the pathogenesis of LGMD1C as a toxic gain of function effect. PMID: 21610159
  24. PKCdelta signaling is required for myoblast fusion by regulating the expression of caveolin-3 and beta1D integrin upstream focal adhesion kinase. PMID: 21346196
  25. Data indicate that Cav-3 increases caveolae formation and induces a "protective phenotype" that is characterized by increaed natriuretic peptide expression and decreased cardiac hypertrophy. PMID: 21616289
  26. both groups of preassembled proteins are maintained in close proximity by caveolin-3, the K(V)4.2/K(V)4.3 channel supramolecular complex, and alpha1-AR, Galphas and adenylate cyclase gather in a second group PMID: 20224290
  27. Depletion of Cav3 induced by delivery of the dominant-negative Cav3 (P104L) form impairs myoblast differentiation via Akt and p38 signalling networks, leading to an immature cell and molecular signature. PMID: 21182936
  28. functional modulation of the Ca(v)3.2 channels by Cav-3 is important for understanding the compartmentalized regulation of Ca(2+) signaling during normal and pathological processes. PMID: 21084288
  29. Opioid-induced preconditioning is dependent on Cav-3 expression and endogenous protection in Cav-3 overexpressing mice is opioid dependent. PMID: 20736437
  30. caveolin 3-containing membrane domains and the calcium release complex are functionally linked and Trisk 95 and Trisk 51 are instrumental to the regulation of this interaction, the integrity of which may be crucial for muscle physiology. PMID: 20565104
  31. Delayed delayed anesthetic preconditioning induced by isoflurane cannot be elicited in caveolin-3-deficient mice, indicating that the presence of caveolae (dependent on caveolin-3 expression) is a prerequisite for delayed protection in the myocardium. PMID: 20418694
  32. These data identify caveolin-3 as a critical component of the signaling machinery that drives nicotinic acetylcholine receptor clustering and controls neuromuscular junction function. PMID: 19940021
  33. GPI-linked proteins were retained intracellularly in tissue samples derived from Cav-1 null mice (i.e., lung endothelial and renal epithelial cells) and Cav-3 null mice (skeletal muscle fibers). PMID: 11997523
  34. Data suggest that loss of Cav-3 expression is sufficient to induce a molecular program leading to cardiac myocyte hypertrophy and cardiomyopathy. PMID: 12138167
  35. Overexpression of caveolin-3 is sufficient to induce severe cardiomyopathy. PMID: 12966035
  36. caveolin-3 is a key player in myoblast fusion PMID: 14517320
  37. caveolin-3 mutations associated with limb girdle muscular dystrophy type 1C disrupt normal cellular signal transduction pathways PMID: 14600260
  38. Recombinant expression of caveolin-3 affects subcellular localization of PFK-M, by targeting PFK-M to plasma membrane and by trans-locating PFK-M to caveolae-enriched membrane domains. Strictly dependent on the concentration of extracellular glucose. PMID: 14633633
  39. loss of caveolin-3 associated with a moderate increase in eNOS activity results in hypertrophic cardiomyopathy PMID: 14645200
  40. the importance of dysferlin-caveolin 3 relationship for skeletal muscle integrity PMID: 14749532
  41. Data suggest that caveolin 3 is an enhancer of insulin signaling in skeletal muscles but does not act as a scaffolding molecule for insulin receptors. PMID: 15314230
  42. Our results demonstrate the importance of Cav-3 in regulating whole body glucose homeostasis in vivo and its possible role in the development of insulin resistance. PMID: 15689413
  43. Caveolins are essential for dysferlin association with the plasma membrane. PMID: 16319126
  44. Flotillin-1 and caveolin-3 may regulate muscle energy metabolism through the spatial and temporal segregation of key components of the insulin signaling, including GLUT4 transport. PMID: 16455755
  45. caveolin-3 was present only in smooth muscles of some specific tissues PMID: 16609918
  46. These findings indicate that normal expression and localization of caveolin-3 are required to appropriately co-ordinate PI(3) kinase/Akt-mediated cell survival signaling. PMID: 16814768
  47. Intermediate filament protein desmin and caveolin-3 associate with each other in myogenic cells. PMID: 17036228
  48. caveolin-3 normally suppresses the myostatin-mediated signal PMID: 17039257
  49. Overexpression of CAR may lead to physiological dysfunction by interfering with normal signaling (through alterations in caveolin-3 and neuronal nitric-oxide synthase levels). PMID: 17148677
  50. caveolin-3 levels are downregulated by nitric oxide through the interaction with myogenin, the transcription factor for caveolin-3 PMID: 17519233

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein. Cell membrane; Peripheral membrane protein. Membrane, caveola; Peripheral membrane protein. Cell membrane, sarcolemma.
Protein Families
Caveolin family
Tissue Specificity
Expressed predominantly in muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*