Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Cma1

Uniprot No.

P21844

Alternative Names

Cma1; Mcpt5Chymase; EC 3.4.21.39; Alpha-chymase; Mast cell chymase 1; Mast cell protease 5; mMCP-5; Mast cell protease I

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

22-246aa

Target Protein Sequence

IIGGTECIPHSRPYMAYLEIVTSENYLSACSGFLIRRNFVLTAAHCAGRSITVLLGAHNKTSKEDTWQKLEVEKQFLHPKYDENLVVHDIMLLKLKEKAKLTLGVGTLPLSANFNFIPPGRMCRAVGWGRTNVNEPASDTLQEVKMRLQEPQACKHFTSFRHNSQLCVGNPKKMQNVYKGDSGGPLLCAGIAQGIASYVHRNAKPPAVFTRISHYRPWINKILRE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

29.2kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion.

Gene References into Functions

Mast cells have the ability to produce and degrade FXIIIA depending on their chymase expression profile: mast cells expressing chymase degrade FXIIIA, whereas mast cells that do not express chymase mainly produce FXIIIA PMID: 27302551
Fibronectin was identified as a target of mMCP-5, and the exocytosis of mMCP-5 from the MCs in the mouse's peritoneal cavity resulted in the expression of metalloproteinase protease-9, which has been implicated in arthritis. PMID: 28193842
mast cell/chymase-mediated intestinal epithelial barrier function is mediated by proteinase-activated receptor 2/MMP-2-dependent PMID: 23306080
The prominent mast cell secretory granule protease MCP-5 is essential for the occurrence of irreversible ischemia-reperfusion injury of skeletal muscle. PMID: 15905575
mast cell chymase activates ERK and p38 probably through G-protein-coupled receptor, and the ERK but not p38 cascade may have a crucial role in chymase-induced migration of eosinophils PMID: 15919053
chymase rapidly cleaves recombinant pro-IL-18 at 56-phenylalanine and produces a biologically active IL-18 fragment that is smaller than any other reported IL-18-derived species PMID: 17142727
Cymase might play an important role in intermittent hypoxia-induced left ventricular remodeling, which is independent of the systemic blood pressure. PMID: 19470876
Just after stopping the angiotensin II infusion, aortic ACE and chymase activities were significantly increased, and were involved in the progression of aortic abdominal aneurysms PMID: 19556720
experimental abdominal aortic aneurysm in wild-type mice or those deficient in the chymase ortholog mouse mMCP-4 or deficient in mMCP-5 (Mcpt4(-/-), Mcpt5(-/-)), Mcpt4(-/-) but not Mcpt5(-/-) had reduced abdominal aortic aneurysm formation PMID: 19720934

Hide All

Subcellular Location

Secreted. Cytoplasmic granule. Note=Secretory granules.

Protein Families

Peptidase S1 family, Granzyme subfamily

Tissue Specificity

Mast cells.

Database Links

KEGG: mmu:17228

STRING: 10090.ENSMUSP00000022834

UniGene: Mm.1252

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP005599MO
MSDS	MSDS
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Chymase (Cma1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage