Recombinant Mouse Cold-inducible RNA-binding protein(Cirbp)


In Stock
Code CSB-EP005440MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P60824
Relevance Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005440MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005440MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Research Area Cell Biology
Source E.coli
Gene Names Cirbp
Protein Names A18 hnRNP Glycine-rich RNA-binding protein CIRP Cirp
Expression Region 1-172aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 22.6 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Subcellular Location Nucleus, nucleoplasm, Cytoplasm
Tissue Specificity Ubiquitous.
Database Links

KEGG: mmu:12696

STRING: 10090.ENSMUSP00000101004

UniGene: Mm.17898

Related Products

Cirbp Antibodies

Cirbp Antibodies for Mus musculus (Mouse)

Cirbp Proteins

Cirbp Proteins for Mus musculus (Mouse)

Cirbp ELISA Kit

Cirbp ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.