Recombinant Mouse Cold-inducible RNA-binding protein (Cirbp)

In Stock
Code CSB-EP005440MO
Abbreviation Recombinant Mouse Cirbp protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005440MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005440MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cirbp.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Cirbp
Uniprot No.
Research Area
Cell Biology
Alternative Names
Cirbp; CirpCold-inducible RNA-binding protein; A18 hnRNP; Glycine-rich RNA-binding protein CIRP
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-172aa
Target Protein Sequence
MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.6 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Citations

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Cell assay

Review: I used the recombinant Mouse Cold-inducible RNA-binding protein (Cirbp), No. CSB-EP005440MO, for cell experiments and confirmed that this protein had proliferative effects on activated T cells. The following is a flow diagram of the T cell proliferation test.

By Anonymous

Target Background

Function
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN.
Gene References into Functions
  1. CIRP induces lung endoplasmic reticulum stress and downstream responses to cause sepsis-associated acute lung injury. PMID: 28128330
  2. Study demonstrates CIRP-induced endothelial cell (EC)pyroptosis in the lungs of C57BL/6 mice for the first time. CIRP stimulates the assembly and activation of Nlrp3 inflammasome in EC accompanied with caspase-1 activation, IL-1beta release and induction of proinflammatory cell death pyroptosis. PMID: 27217302
  3. tissue damage induced NADPH oxidase activation and increased the release of reactive oxygen species via cold-inducible RNA-binding protein (CIRP)-TLR4-MyD88 signaling. PMID: 28492546
  4. temperature-dependent accumulation of Cirbp mRNA is controlled primarily by the regulation of splicing efficiency, defined as the fraction of Cirbp pre-mRNA processed into mature mRNA PMID: 27633015
  5. this paper shows that cold air stimulation induced MUC5AC expression in wild-type mice but not in CIRP-/-) mice. PMID: 27423012
  6. state. These data collectively suggest that a deficiency in CIRP accelerates the wound healing process PMID: 26743936
  7. These results can provide new insights into the molecular mechanisms of Cirp function. PMID: 25597958
  8. Findings suggest that CIRP could exert protective effects against oxidative stress, and that it might be a novel neuroprotective agent PMID: 25498861
  9. targeting CIRP offers potential therapeutic implications in the treatment of hepatic I/R injury. PMID: 25186836
  10. Cirp appears to play a critical carcinogenic function and its expression might be a useful biomarker for hepatocellular carcinomas risk prediction. PMID: 25611373
  11. Cirp promotes the development of intestinal inflammation and colorectal tumors through regulating apoptosis and production of TNFalpha and IL23 in inflammatory cells. PMID: 25187386
  12. alcohol exposure activates microglia to produce and secrete CIRP PMID: 24223948
  13. Extracellular CIRP is a detrimental factor in stimulating inflammation to cause neuronal damage in cerebral ischemia PMID: 24613680
  14. Down-regulated CIRP is involved in testicular injury after testicular torsion/detorsion. PMID: 24094970
  15. Depletion of Cirbp is found to increase the susceptibility of cells to the TNF-mediated inhibition of high amplitude expression of clock genes and modulates the TNF-induced cytokine response. PMID: 24337574
  16. In animal models of hemorrhage and sepsis, CIRP is upregulated in the heart and liver and released into the circulation. In macrophages under hypoxic stress, CIRP translocates from the nucleus to the cytosol and is released. PMID: 24097189
  17. Moderate hypothermia resulted in significant up-regulation of both RBM3 and CIRP mRNA in murine organotypic hippocampal slice cultures PMID: 23415676
  18. we discovered that downregulation of CIRP resulted in increased germ cell apoptosis, possibly via the activation of the p44/p42, p38 and SAPK/JNK MAPK pathways PMID: 23001445
  19. mRNAs binding with CIRP in testis were mostly associated with translation regulator activity, antioxidant activity, envelope and reproduction, including important mRNAs related to male infertility. PMID: 22819822
  20. CIRP confers robustness to circadian oscillators through regulation of CLOCK expression. PMID: 22923437
  21. Cirp functions to fine-tune the proliferation of undifferentiated spermatogonia by interacting with Dyrk1b. PMID: 22711815
  22. These data suggest that mild hypothermia protects cells from TNF-alpha-induced apoptosis, at least partly, via induction of Cirp, and that Cirp protects cells by activating the ERK pathway. PMID: 16569452
  23. These findings further reveal the diversity of mechanisms by which CIRP is regulated by environmental stresses and provide new insights into CIRP cytoplasmic function. PMID: 17967451
  24. CIRP enhanced extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation, and treatment with an MEK inhibitor decreased the proliferation caused by CIRP. PMID: 19158277
  25. Overexpression of CIRP may reduce testicular damage induced by cryptorchidism by down-regulating the levels of p53 and Fas. PMID: 19331798

Show More

Hide All

Subcellular Location
Nucleus, nucleoplasm. Cytoplasm.
Tissue Specificity
Ubiquitous.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*