Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

In Stock
Code CSB-EP875360MO
Abbreviation Recombinant Mouse C1qtnf3 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP875360MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP875360MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) C1qtnf3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
C1qtnf3
Uniprot No.
Research Area
Metabolism
Alternative Names
C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necrosis factor-related protein 3; Collagenous repeat-containing sequence 26 kDa protein; CORS26; Secretory protein CORS26
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
23-246aa
Target Protein Sequence
QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of recombinant mouse complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) begins with isolating the C1qtnf3 protein-encoding gene (23-246aa). This gene is cloned into an expression vector with an N-terminal 10xHis-tag gene and a C-terminal Myc-tag gene and then transfected into E.coli cells through transformation. The E.coli cells express the protein, which is then harvested from the cell lysate. The protein is purified using affinity chromatography. Finally, the protein's purity is measured by SDS-PAGE, reaching over 90%.

Mouse C1qtnf3, also known as CTRP3, is a protein that has been implicated in various physiological processes and diseases. Studies have shown that C1qtnf3 is highly expressed in mouse models of arthritis, where it plays a protective role by attenuating systemic inflammation and reducing arthritis severity [1][2]. C1qtnf3 promotes the proliferation and migration of mouse endothelial cells [3]. In the context of adipose tissue remodeling, C1qtnf3 is upregulated during subcutaneous adipose tissue remodeling and stimulates macrophage chemotaxis and M1-like polarization [4].

Furthermore, C1qtnf3 has been identified as a downstream molecule of HIF-1α, exerting anti-catabolic effects through the suppression of NF-κB signaling [5]. In the ovary, C1qtnf3 plays a role in folliculogenesis, with its expression being significantly decreased by excess androgen [6]. C1qtnf3 also regulates chondrogenic cell proliferation via the adiponectin receptor 2 [7].

References:
[1] A. Myngbay, L. Manarbek, S. Ludbrook, & J. Kunz, The role of collagen triple helix repeat-containing 1 protein (cthrc1) in rheumatoid arthritis, International Journal of Molecular Sciences, vol. 22, no. 5, p. 2426, 2021. https://doi.org/10.3390/ijms22052426
[2] M. Murayama, S. Kakuta, T. Maruhashi, K. Shimizu, A. Seno, S. Kuboet al., Ctrp3 plays an important role in the development of collagen-induced arthritis in mice, Biochemical and Biophysical Research Communications, vol. 443, no. 1, p. 42-48, 2014. https://doi.org/10.1016/j.bbrc.2013.11.040
[3] A. Coussens, C. Wilkinson, I. Hughes, C. Morris, A. Daal, P. Andersonet al., Unravelling the molecular control of calvarial suture fusion in children with craniosynostosis, BMC Genomics, vol. 8, no. 1, 2007. https://doi.org/10.1186/1471-2164-8-458
[4] P. Micallef, M. Vujičić, Y. Wu, E. Peris, Y. Wang, B. Chanclónet al., C1qtnf3 is upregulated during subcutaneous adipose tissue remodeling and stimulates macrophage chemotaxis and m1-like polarization, Frontiers in Immunology, vol. 13, 2022. https://doi.org/10.3389/fimmu.2022.914956
[5] K. Okada, D. Mori, Y. Makii, H. Nakamoto, Y. Murahashi, F. Yanoet al., Hypoxia-inducible factor-1 alpha maintains mouse articular cartilage through suppression of nf-κb signaling, Scientific Reports, vol. 10, no. 1, 2020. https://doi.org/10.1038/s41598-020-62463-4
[6] Z. Mao, L. Yang, X. Lu, A. Tan, Y. Wang, F. Dinget al., C1qtnf3 in the murine ovary and its function in folliculogenesis, Reproduction, vol. 155, no. 4, p. 333-346, 2018. https://doi.org/10.1530/rep-17-0783
[7] M. Murayama and Y. Iwakura, C1q/tnf-related protein 3 regulates chondrogenic cell proliferation via adiponectin receptor 2 (progestin and adipoq receptor 2), Translational and Regulatory Sciences, vol. 2, no. 1, p. 19-23, 2020. https://doi.org/10.33611/trs.2_19

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : SUnSET assay

Review: mice were cultured for 5days in vitro (5DIV) and treated with 5μg/ml mCTRP3 protein for 6 or 24h.

By Anonymous

Target Background

Gene References into Functions
  1. Low C1QTNF3 expression is associated with polycystic ovarian syndrome. PMID: 29438034
  2. Although it is dispensable for physiological control of energy balance, CTRP3 plays a previously unsuspected role in modulating liver size and circulating cytokine levels in response to obesity. PMID: 26670485
  3. CTRP3 was expressed in developing skeletal muscle tissues, and the expression level of CTRP3 was increased during myogenic differentiation of C2C12 cells. PMID: 26272338
  4. Our study suggests that CTRP3 prevents osteoclast differentiation PMID: 26103094
  5. Data suggest that CTRP3 up-regulates expression and secretion of adipokines (adiponectin, leptin, visfatin, and apelin) in adipocytes; these responses to CTRP3 are down-regulated by insulin resistance or inhibition of AMPK signaling pathway. PMID: 25168658
  6. present study shows the proof of principle that the novel adipokine CTRP-3 is a potent inhibitor of LPS-induced systemic inflammation and LPS-induced signaling in adipose tissue in vivo PMID: 24996172
  7. CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway. PMID: 24578384
  8. These observations indicate that CTRP3 plays an important role in the development of autoimmune arthritis, suggesting CTRP3 as a possible medicine to treat rheumatoid arthritis. PMID: 24269820
  9. results establish a novel role for C1q tumor necrosis factor-related protein 3 (CTRP3) in regulating hepatic lipid metabolism and highlight its protective function and therapeutic potential in attenuating hepatic steatosis PMID: 23744740
  10. c-Jun is a cis-acting element for CTRP3 regulation in chondrogenic cells. PMID: 22644487
  11. CTRP3 is a novel antiapoptotic, proangiogenic, and cardioprotective adipokine, the expression of which is significantly inhibited after myocardial infarction. PMID: 22653084
  12. This study provides the first functional evidence linking CTRP3 to hepatic glucose metabolism and establishes CTRP3 as a novel adipokine. PMID: 20952387
  13. Exogenous CTRP3/cartducin promoted the proliferation of p53LMAC01 cells in a dose-dependent manner via ERK1/2 (extracellular signal-regulated kinase 1/2)- and MAPK (p38 mitogen-activated protein kinase)-signalling pathways PMID: 19947921
  14. Genomic organization, chromosomal localization and adipocytic expression of the murine gene for CORS-26 PMID: 12850274
  15. the murine CORS-26 promoter is transcriptionally regulated by specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 PMID: 15157741
  16. Cartducin is a novel growth factor and plays important roles in regulating both chondrogenesis and cartilage development by its direct stimulatory action on the proliferation of chondrogenic precursors and chondrocytes. PMID: 16155912
  17. CORS-26 up-regulates adipokine secretion and might be involved in metabolic and immunologic pathways. PMID: 17299102
  18. Elevated expression of CTRP3/cartducin contributes to promotion of osteosarcoma cell proliferation PMID: 19424626

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*