Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3)

In Stock
Code CSB-MP875360MO
Abbreviation Recombinant Mouse C1qtnf3 protein
MSDS
Size $660
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
C1qtnf3
Uniprot No.
Research Area
Metabolism
Alternative Names
C1qtnf3; Cors26; Ctrp3; Complement C1q tumor necrosis factor-related protein 3; Collagenous repeat-containing sequence 26 kDa protein; CORS26; Secretory protein CORS26
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
23-246aa
Target Protein Sequence
QDEYMESPQAGGLPPDCSKCCHGDYGFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGVPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYETKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Complement C1q tumor necrosis factor-related protein 3 (C1qtnf3) is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. The protein is expressed as a full-length mature protein, spanning amino acids 23 to 246. It features an N-terminal 10xHis-tag for simplified purification. With a purity level exceeding 85% as determined by SDS-PAGE, this protein seems suitable for various research applications.

C1q tumor necrosis factor-related protein 3 (C1qtnf3) belongs to the C1q/TNF superfamily and is known to be involved in numerous biological processes. Research suggests it plays a role in inflammation and immune response regulation. The protein has also drawn interest in metabolic pathway studies. Its involvement in these pathways makes it a significant focus in research areas seeking to understand cellular communication and response mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse C1qtnf3 is a secretory adipokine that requires proper folding, disulfide bond formation, and trimerization for its functional activity in metabolic regulation. The mammalian cell expression system provides the optimal environment for eukaryotic protein folding, post-translational modifications, and complex assembly. However, even in mammalian systems, protein folding is not guaranteed to be 100% correct. The N-terminal 10xHis tag is relatively small but may potentially interfere with the protein's N-terminal structural organization. While the probability of correct folding is high, experimental validation is essential to confirm functional trimerization and activity.

1. Antibody Development and Validation Studies

Antibody development can proceed based on sequence, but conformation-specific antibodies require proper trimerization validation.

If Correctly Folded (Verified): Excellent for generating conformation-sensitive antibodies that recognize native C1qtnf3 epitopes, particularly important for this trimeric protein.

If Misfolded/Unverified: Suitable for producing antibodies against linear epitopes, but these may not efficiently recognize the native trimeric structure in biological samples.

2. Protein-Protein Interaction Studies

C1qtnf3 interactions depend on a precise quaternary structure that must be confirmed experimentally.

If Correctly Folded (Verified): Highly suitable for identifying physiological binding partners (e.g., receptors, adipokine network proteins) with high confidence in interaction data.

If Misfolded/Unverified: High risk of non-specific binding or failure to interact; may produce biologically misleading results due to improper trimerization.

3. Biochemical Characterization and Stability Studies

These studies provide critical quality control data to determine folding status and trimerization capability.

If Correctly Folded (Verified): Essential for validating trimerization state, thermal stability, and structural integrity using techniques like SEC-MALS and CD spectroscopy.

If Misfolded/Unverified: Still valuable for assessing physical properties, but characterizes non-native protein structure.

4. Comparative Species Analysis

Valid comparative studies require the protein to be in its native trimeric conformation.

If Correctly Folded (Verified): Ideal for meaningful cross-species comparisons of structural stability, oligomerization behavior, and functional conservation.

If Misfolded/Unverified: Comparative analyses would yield misleading results, as differences may reflect misfolding rather than genuine evolutionary variations.

Final Recommendation & Action Plan

The mammalian expression system provides a high probability of correct folding for this adipokine, but experimental validation of trimerization and structural integrity is essential before reliable use in functional studies. The immediate priority is Application 3 (Biochemical Characterization) to assess trimerization state via size-exclusion chromatography with multi-angle light scattering (SEC-MALS) and validate structural integrity through circular dichroism spectroscopy. If correct folding and trimerization are verified, proceed confidently with Applications 1 (conformational antibodies), 2, and 4 for interaction studies, antibody development, and comparative analyses. If misfolding is detected, limit applications to linear epitope antibody production (Application 1) and basic biophysical characterization (Application 3), avoiding all functional interaction and comparative studies. For all applications, include appropriate controls and consider the potential need for tag removal if the His-tag interferes with trimerization. This systematic approach ensures appropriate use based on experimental validation of protein folding and oligomerization status.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Low C1QTNF3 expression is associated with polycystic ovarian syndrome. PMID: 29438034
  2. Although it is dispensable for physiological control of energy balance, CTRP3 plays a previously unsuspected role in modulating liver size and circulating cytokine levels in response to obesity. PMID: 26670485
  3. CTRP3 was expressed in developing skeletal muscle tissues, and the expression level of CTRP3 was increased during myogenic differentiation of C2C12 cells. PMID: 26272338
  4. Our study suggests that CTRP3 prevents osteoclast differentiation PMID: 26103094
  5. Data suggest that CTRP3 up-regulates expression and secretion of adipokines (adiponectin, leptin, visfatin, and apelin) in adipocytes; these responses to CTRP3 are down-regulated by insulin resistance or inhibition of AMPK signaling pathway. PMID: 25168658
  6. present study shows the proof of principle that the novel adipokine CTRP-3 is a potent inhibitor of LPS-induced systemic inflammation and LPS-induced signaling in adipose tissue in vivo PMID: 24996172
  7. CTRP3 promotes vascular calcification by enhancing phosphate-induced osteogenic transition of VSMC through reactive oxygen species-extracellular signal-regulated kinase 1/2-Runx2 pathway. PMID: 24578384
  8. These observations indicate that CTRP3 plays an important role in the development of autoimmune arthritis, suggesting CTRP3 as a possible medicine to treat rheumatoid arthritis. PMID: 24269820
  9. results establish a novel role for C1q tumor necrosis factor-related protein 3 (CTRP3) in regulating hepatic lipid metabolism and highlight its protective function and therapeutic potential in attenuating hepatic steatosis PMID: 23744740
  10. c-Jun is a cis-acting element for CTRP3 regulation in chondrogenic cells. PMID: 22644487
  11. CTRP3 is a novel antiapoptotic, proangiogenic, and cardioprotective adipokine, the expression of which is significantly inhibited after myocardial infarction. PMID: 22653084
  12. This study provides the first functional evidence linking CTRP3 to hepatic glucose metabolism and establishes CTRP3 as a novel adipokine. PMID: 20952387
  13. Exogenous CTRP3/cartducin promoted the proliferation of p53LMAC01 cells in a dose-dependent manner via ERK1/2 (extracellular signal-regulated kinase 1/2)- and MAPK (p38 mitogen-activated protein kinase)-signalling pathways PMID: 19947921
  14. Genomic organization, chromosomal localization and adipocytic expression of the murine gene for CORS-26 PMID: 12850274
  15. the murine CORS-26 promoter is transcriptionally regulated by specificity protein-1, PPARgamma, and pituitary protein transcription factor-1 PMID: 15157741
  16. Cartducin is a novel growth factor and plays important roles in regulating both chondrogenesis and cartilage development by its direct stimulatory action on the proliferation of chondrogenic precursors and chondrocytes. PMID: 16155912
  17. CORS-26 up-regulates adipokine secretion and might be involved in metabolic and immunologic pathways. PMID: 17299102
  18. Elevated expression of CTRP3/cartducin contributes to promotion of osteosarcoma cell proliferation PMID: 19424626

Show More

Hide All

Subcellular Location
Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*