Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Ckm

Uniprot No.

P07310

Research Area

Metabolism

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-381aa

Target Protein Sequence

MPFGNTHNKFKLNYKPQEEYPDLSKHNNHMAKVLTPDLYNKLRDKETPSGFTLDDVIQTGVDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLANLSKHPKFEEILTRLRLQKRGTGGVDTAAVGAVFDISNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

49.0 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Reversibly catalyzes the transfer of phosphate between ATP and various phosphogens (e.g. creatine phosphate). Creatine kinase isoenzymes play a central role in energy transduction in tissues with large, fluctuating energy demands, such as skeletal muscle, heart, brain and spermatozoa.

Gene References into Functions

We conclude that ILK negatively and independently of PI3K regulated MEF2C phosphorylation activity and MCK mRNA expression in C2C12 cells PMID: 26788505
The Fxn KO/Mck mice tested from one to two months of age showed abnormal gait patterns accompanied by a loss in motor skills. PMID: 25765157
PI3K and AKT regulated skeletal muscle differentiation by regulating the expression of Myogenin and MCK. PMID: 23732671
CK-M overexpression led to significantly increased contractile function at baseline and during adrenergic stimulation and increased survival after thoracic aortic constriction-induced heart failure. PMID: 22201686
strong down-regulation of MCK activity contributes to F-actin instability and induces post-translational modification of alphaB-crystallin and desmin PMID: 21768101
These studies indicate that the age-associated oxidative and nitrative modification of CKm results in a decrease in its activity and may cause structural changes that promote oligomerization and aggregation. PMID: 20195383
Not involved in levels of creatine nnd creatine kinase in skeletal muscle of knockout mice. PMID: 12640020
one of the consequences of M-CK and AK1 deficiency is hampered phosphoryl delivery to the actomyosin ATPase, resulting in a loss of contractile performance. PMID: 12730234
Allosteric activation of phosphorylase b accounts for the accelerated glycogenolysis in CK-/- muscle during contraction. PMID: 12963789
Data show that Six4 is transcriptional regulatory element X (TrexBF) in skeletal myocytes and transactivates the muscle creatine kinase enhancer PMID: 14966291
the expression of muscle creatine kinase (MCK) gene in the heart and skeletal muscle of mice during aging PMID: 15040454
metabolic failure induced by CK deficiency profoundly affects the ability of mice to engage in chronic bouts of endurance running exercise and that this decrease in performance is also associated with muscle wasting PMID: 15831533
CK-MM autoantibodies can modulate the rate of CK clearance from the circulation in myositis PMID: 16810680
Data show that spatial relations among organelles of muscle cells undergo adaptation in response to nonstructural stimuli such as metabolic (creatine kinase)deficiency. PMID: 16855221
The creatine kinase energy transport system was evaluated in the failing mouse heart. PMID: 17481652
Dec proteins repressed a MyoD-activated promoter activity of muscle creatine kinase gene through class A E-box in an HDAC1-independent manner. PMID: 17487425
Creatine kinase (CK) and adenylate kinase (AK) are especially important in facilitating energy metabolism during very high energy demands. PMID: 19156695

Hide All

Subcellular Location

Cytoplasm.

Protein Families

ATP:guanido phosphotransferase family

Database Links

KEGG: mmu:12715

STRING: 10090.ENSMUSP00000003643

UniGene: Mm.2375

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-EP005459MO
MSDS	MSDS
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Creatine kinase M-type (Ckm)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage