Home
Protein
Recombinant Proteins
Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad)

Recombinant Mouse Cysteine sulfinic acid decarboxylase (Csad)

^{In Stock}

Code	CSB-EP006032MO
Abbreviation	Recombinant Mouse Csad protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Csad

Uniprot No.

Q9DBE0

Research Area

Others

Alternative Names

CsadCysteine sulfinic acid decarboxylase; EC 4.1.1.29; Aspartate 1-decarboxylase; EC 4.1.1.11; Cysteine-sulfinate decarboxylase; Sulfinoalanine decarboxylase

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-493aa

Target Protein Sequence

MADSKPLRTLDGDPVAVEALLQDVFGIVVDEAILKGTSASEKVCEWKEPEELKQLLDLELQSQGESREQILERCRTVIHYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLKKLRALVGWNSGDGVFCPGGSISNMYAMNLARFQRYPDCKQRGLRALPPLALFTSKECHYSITKGAAFLGLGTDSVRVVKADERGRMIPEDLERQIILAEAEGSVPFLVSATSGTTVLGAFDPLDAIADVCQRHGLWFHVDAAWGGSVLLSRTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLRDTSNLLKRCHGSQASYLFQQDKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGGQGLERRIDQAFALTRYLVEEIKKREGFELVMEPEFVNVCFWFVPPSLRGKKESPDYSQRLSQVAPVLKERMVKKGTMMIGYQPHGTRANFFRMVVANPILAQADIDFLLGELELLGQDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

71.1kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Incorporation of the gene encoding the Mouse Csad protein (1-493aa) into a plasmid vector forms recombinant plasmid, which is then transformed into e.coli cells. baculovirus cells containing the recombinant plasmid that can survive in the presence of a specific antibiotic are selected and cultured under conditions conducive to the expression of the gene of interest. The protein features a N-terminal 6xHis-SUMO tag fusion. Following expression, the recombinant Mouse Csad protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant protein, demonstrating a purity greater than 90%.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Catalyzes the decarboxylation of L-aspartate, 3-sulfino-L-alanine (cysteine sulfinic acid), and L-cysteate to beta-alanine, hypotaurine and taurine, respectively. The preferred substrate is 3-sulfino-L-alanine. Does not exhibit any decarboxylation activity toward glutamate.

Gene References into Functions

Estradiol decreases taurine concentration mainly via the reduction of cysteine sulfinic acid decarboxylase expression level through the ER-alpha. PMID: 25394658
cDNA sequence that predicts a polypeptide of 493 amino acids - both sequences given PMID: 11997111
The results show that CSD is expressed both at the mRNA and protein levels in the testis, epididymis and ductus deferens. PMID: 16252094

Protein Families

Group II decarboxylase family

Tissue Specificity

Expressed in kidney and liver not detected in lymphoid tissues and lung. Expressed in kidney, liver and brain. 7 and 4 times higher expression in kidney and liver than in brain, respectively. Low level of detection in skeletal muscle. Expressed in brain,

Database Links

KEGG: mmu:246277

STRING: 10090.ENSMUSP00000023805

UniGene: Mm.296382

Promotions