Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Dcn

Uniprot No.

P28654

Alternative Names

Dcn; Decorin; Bone proteoglycan II; PG-S2; PG40

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

35-354aa

Target Protein Sequence

GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

51.9kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Mouse Dcn covers amino acids 35-354. The theoretical molecular weight of the Dcn protein is 51.9 kDa. This protein is generated in a e.coli-based system. The Dcn gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Dcn protein during the following stages.

Decorin (Dcn) in mice is a proteoglycan primarily found in the extracellular matrix (ECM) of connective tissues. It plays a crucial role in regulating collagen fibrillogenesis and maintaining tissue structure. Decorin binds to collagen fibers, influencing their organization and providing mechanical strength to tissues. Beyond its structural functions, decorin also modulates cellular processes, including cell adhesion, proliferation, and migration. Its ability to interact with growth factors and receptors makes decorin a key player in tissue homeostasis, wound healing, and inflammation. Research areas involving decorin often explore its implications in tissue development, musculoskeletal disorders, cancer progression, and therapeutic applications aimed at manipulating ECM dynamics for tissue repair and regeneration.

Code	CSB-EP006554MO
Abbreviation	Recombinant Mouse Dcn protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Decorin (Dcn), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage