Recombinant Mouse Decorin (Dcn), partial

In Stock
Code CSB-EP006554MO
Abbreviation Recombinant Mouse Dcn protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
Dcn; Decorin; Bone proteoglycan II; PG-S2; PG40
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
35-354aa
Target Protein Sequence
GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Mouse Dcn covers amino acids 35-354. The theoretical molecular weight of the Dcn protein is 51.9 kDa. This protein is generated in a e.coli-based system. The Dcn gene fragment has been modified by fusing the N-terminal 6xHis-SUMO tag, providing convenience in detecting and purifying the recombinant Dcn protein during the following stages.

Decorin (Dcn) in mice is a proteoglycan primarily found in the extracellular matrix (ECM) of connective tissues. It plays a crucial role in regulating collagen fibrillogenesis and maintaining tissue structure. Decorin binds to collagen fibers, influencing their organization and providing mechanical strength to tissues. Beyond its structural functions, decorin also modulates cellular processes, including cell adhesion, proliferation, and migration. Its ability to interact with growth factors and receptors makes decorin a key player in tissue homeostasis, wound healing, and inflammation. Research areas involving decorin often explore its implications in tissue development, musculoskeletal disorders, cancer progression, and therapeutic applications aimed at manipulating ECM dynamics for tissue repair and regeneration.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May affect the rate of fibrils formation.
Gene References into Functions
  1. The absence of a dermatan sulfate chain on decorin does not appear to overtly influence its functional properties in vivo. PMID: 28412940
  2. Fibroblasts differentiated to adipocytes and treated with TIP39 also showed increased decorin and production of chondroitin sulfate. Furthermore, the skin of PTH2R(-/-) mice showed abnormal extracellular matrix structure, decreased decorin expression, and skin hardness. PMID: 28454729
  3. The disruption of decorin-restricted TGFbeta signalling leads to higher stiffness of articular cartilage matrix, rendering joints more resistant to osteoarthritis. PMID: 27377816
  4. We could show that ablation of either candidate enhanced adipogenesis in visceral preadipocytes, while treatment of primary cultures with recombinant Sparcl1 and Dcn blocked adipogenesis in a dose dependent manner. In conclusion, our data suggests that the differences in adipogenesis between depots might be due to paracrine and autocrine feedback mechanisms which could in turn contribute to metabolic homeostasis PMID: 27317982
  5. A synthetic peptide corresponding to this decorin region dose-dependently inhibited the response to myostatin in cardiomyocytes PMID: 27559042
  6. Systemic delivery of an oncolytic adenovirus expressing decorin for the treatment of breast cancer bone metastases reduced tumor burden and inhibited bone destruction. PMID: 26467629
  7. Decorin is an autophagy-inducible proteoglycan and is required for proper in vivo autophagy. PMID: 26344480
  8. The results suggest that decorin plays a dual role in AAA. Adventitial decorin in normal aorta may protect against the development of AAA PMID: 25781946
  9. Development of congenital stromal dystrophy is dependent on export and extracellular deposition of truncated decorin. PMID: 26029887
  10. decorin may modulate follicular cycling and morphogenesis PMID: 24816226
  11. We found that decorin is abundantly secreted and deposited in normal connective tissue but its expression is consistently decreased in the tumor microenvironment. PMID: 24634138
  12. Decorin signaling supported fetal membrane remodeling at early stages of gestation in a TGFbeta-dependent manner, and fetal membrane stabilization at later stages of gestation without changes in TGFbeta levels. PMID: 24373743
  13. A decorin-deficient matrix affects skin chondroitin/dermatan sulfate levels and keratinocyte function. PMID: 24447999
  14. Decorin deficiency promotes hepatic carcinogenesis. PMID: 24361483
  15. decorin secreted from myotubes in response to exercise is involved in the regulation of muscle hypertrophy and hence could play a role in exercise-related restructuring processes of skeletal muscle. PMID: 24996176
  16. the gene encoding the small leucine-rich proteoglycan decorin is repressed by FOXD1 in cortical interstitial cells, compound genetic inactivation of DCN partially rescues the failure of progenitor cell differentiation in the Foxd1 null. PMID: 24284212
  17. Dimerization could be abolished by engineering glycosylation sites into the dimer interface; other interface mutants remained dimeric. The monomeric mutants were as stable as wild-type decorin in thermal unfolding experiments. PMID: 24169694
  18. Decorin lacking c-terminal repeat is retained intracellularly, its accumulation triggering endoplasmic reticulum stress that results in abnormal synthesis and secretion, leading to congenital stromal corneal dystrophy. PMID: 23685109
  19. Alterations in glycosylated decorin core protein might be implicated in myocardial remodeling and reverse remodeling, with a potential important role for CS/DS GAG chain-synthesizing enzymes. PMID: 23412898
  20. decorin induced VEGFR2-dependent mitochondrial fragmentation and loss of mitochondrial membrane potential PMID: 23798385
  21. decorin modulates delayed-type hypersensitivity responses by augmenting the induction of downstream effector cytokines of IFN-gamma and TNF-alpha, thereby influencing the recruitment of CD8(+) lymphocytes into the inflamed tissue. PMID: 23460644
  22. Lack of decorin leads to enhanced tumor formation in the liver. PMID: 23448253
  23. These data show for the first time that decorin has an impact on the biology of alpha2beta1 integrin and the vimentin intermediate filament system. PMID: 23226541
  24. DCN gene can inhibit the growth of nude mice xenograft, which is probably related with the decreased expressions of TGF-beta1 and MMP-9 protein and the inhibition of tumor angiogenesis. PMID: 23046927
  25. Decorin protein core affects the global gene expression profile of the tumor microenvironment in a triple-negative orthotopic breast carcinoma xenograft model. PMID: 23029096
  26. decorin plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis PMID: 22482685
  27. The expression of decorin, a naturally occurring TGF-beta suppressor, was elevated in Mstn-null mice. PMID: 22277753
  28. Decorin regions LRR6 and LRR5 participate in the interaction with LRP-1 and TGF-beta as well as in its dependent signaling. PMID: 22203668
  29. Wild type N-ras appears to mediate its anti-malignant effect by downregulating decorin expression. PMID: 21809347
  30. decorin prevented translational repression of PDCD4 by decreasing the activity of transforming growth factor-beta1 and the abundance of oncogenic miR-21, a translational inhibitor of PDCD4. PMID: 22087031
  31. Cleavage product of decorin serves as a functional receptor of resistin in adipocyte progenitors and may regulate white adipose tissue expansion. PMID: 21683670
  32. gradual increase in muscle regeneration PMID: 21416223
  33. these results implicated a role for decorin in mediating delayed-type hypersensitivity responses by influencing polymorphonuclear leukocyte attachment to the endothelium. PMID: 22043007
  34. Decorin is expressed in placenta/fetal membranes and is developmentally regulated in fetal membranes; data from mutant mouse strains suggest that both decorin and biglycan contribute to gestational success (i.e., prevent premature birth). PMID: 21502335
  35. We show a so far unknown function of decorin and chondroitin-6-sulfate: their ability to inhibit B16V cell migration by intracellular acidification. PMID: 21792923
  36. CTGF specifically induced the synthesis of decorin, suggesting a mechanism of autoregulation. PMID: 21454550
  37. Decorin can modify collagen I-stimulated, but not fibronectin-stimulated myoblast migration in vitro. PMID: 21059388
  38. decorin is a protective agent during the development of diabetic nephropathy PMID: 20083846
  39. Dcn has been identified as an imprinted gene by high-throughput screening using RIKEN cDNA microarray. PMID: 11820791
  40. decorin is dramatically induced in the desmin-null myocardium PMID: 11891192
  41. decorin exerts beneficial effects on tubulointerstitial fibrosis PMID: 11891213
  42. decorin binds fibrinogen in a Zn2+-dependent interaction PMID: 12582160
  43. decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan PMID: 12666199
  44. Inhibition of myoblast migration via decorin expression is critical for normal skeletal muscle differentiation. PMID: 12871697
  45. These alterations in lung tissue mechanical behavior in Dcn-/- mice support a critical role for decorin in the formation of the lung collagen network. PMID: 15447936
  46. in DCN-deficient mice, the growth of corneal vessels was significantly diminished PMID: 15528932
  47. Results describe the effect of bone morphogenetic protein-2 (BMP-2) on the synthesis of proteoglycan during osteogenic conversion of myoblasts and suggest a role for decorin in cell response to BMP-2. PMID: 15920756
  48. decorin is not required for cell survival PMID: 15949467
  49. decorin is required for the proper fibrotic evolution of myocardial infarctions PMID: 15949932
  50. systemic overexpression of decorin reduces inflammation, triglycerides and fibrosis in atherosclerotic plaques of ApoE(-/-) mice resulting in slowing down of disease progression PMID: 16183063

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*