Recombinant Mouse Decorin(Dcn) ,partial

In Stock
Code CSB-EP006554MO
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Dcn
Uniprot No. P28654
Alternative Names Dcn; Decorin; Bone proteoglycan II; PG-S2; PG40
Species Mus musculus (Mouse)
Source E.coli
Expression Region 35-354aa
Target Protein Sequence GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 51.9kDa
Protein Length Partial
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function May affect the rate of fibrils formation.
Gene References into Functions
  1. The absence of a dermatan sulfate chain on decorin does not appear to overtly influence its functional properties in vivo. PMID: 28412940
  2. Fibroblasts differentiated to adipocytes and treated with TIP39 also showed increased decorin and production of chondroitin sulfate. Furthermore, the skin of PTH2R(-/-) mice showed abnormal extracellular matrix structure, decreased decorin expression, and skin hardness. PMID: 28454729
  3. The disruption of decorin-restricted TGFbeta signalling leads to higher stiffness of articular cartilage matrix, rendering joints more resistant to osteoarthritis. PMID: 27377816
  4. We could show that ablation of either candidate enhanced adipogenesis in visceral preadipocytes, while treatment of primary cultures with recombinant Sparcl1 and Dcn blocked adipogenesis in a dose dependent manner. In conclusion, our data suggests that the differences in adipogenesis between depots might be due to paracrine and autocrine feedback mechanisms which could in turn contribute to metabolic homeostasis PMID: 27317982
  5. A synthetic peptide corresponding to this decorin region dose-dependently inhibited the response to myostatin in cardiomyocytes PMID: 27559042
  6. Systemic delivery of an oncolytic adenovirus expressing decorin for the treatment of breast cancer bone metastases reduced tumor burden and inhibited bone destruction. PMID: 26467629
  7. Decorin is an autophagy-inducible proteoglycan and is required for proper in vivo autophagy. PMID: 26344480
  8. The results suggest that decorin plays a dual role in AAA. Adventitial decorin in normal aorta may protect against the development of AAA PMID: 25781946
  9. Development of congenital stromal dystrophy is dependent on export and extracellular deposition of truncated decorin. PMID: 26029887
  10. decorin may modulate follicular cycling and morphogenesis PMID: 24816226
  11. We found that decorin is abundantly secreted and deposited in normal connective tissue but its expression is consistently decreased in the tumor microenvironment. PMID: 24634138
  12. Decorin signaling supported fetal membrane remodeling at early stages of gestation in a TGFbeta-dependent manner, and fetal membrane stabilization at later stages of gestation without changes in TGFbeta levels. PMID: 24373743
  13. A decorin-deficient matrix affects skin chondroitin/dermatan sulfate levels and keratinocyte function. PMID: 24447999
  14. Decorin deficiency promotes hepatic carcinogenesis. PMID: 24361483
  15. decorin secreted from myotubes in response to exercise is involved in the regulation of muscle hypertrophy and hence could play a role in exercise-related restructuring processes of skeletal muscle. PMID: 24996176
  16. the gene encoding the small leucine-rich proteoglycan decorin is repressed by FOXD1 in cortical interstitial cells, compound genetic inactivation of DCN partially rescues the failure of progenitor cell differentiation in the Foxd1 null. PMID: 24284212
  17. Dimerization could be abolished by engineering glycosylation sites into the dimer interface; other interface mutants remained dimeric. The monomeric mutants were as stable as wild-type decorin in thermal unfolding experiments. PMID: 24169694
  18. Decorin lacking c-terminal repeat is retained intracellularly, its accumulation triggering endoplasmic reticulum stress that results in abnormal synthesis and secretion, leading to congenital stromal corneal dystrophy. PMID: 23685109
  19. Alterations in glycosylated decorin core protein might be implicated in myocardial remodeling and reverse remodeling, with a potential important role for CS/DS GAG chain-synthesizing enzymes. PMID: 23412898
  20. decorin induced VEGFR2-dependent mitochondrial fragmentation and loss of mitochondrial membrane potential PMID: 23798385
  21. decorin modulates delayed-type hypersensitivity responses by augmenting the induction of downstream effector cytokines of IFN-gamma and TNF-alpha, thereby influencing the recruitment of CD8(+) lymphocytes into the inflamed tissue. PMID: 23460644
  22. Lack of decorin leads to enhanced tumor formation in the liver. PMID: 23448253
  23. These data show for the first time that decorin has an impact on the biology of alpha2beta1 integrin and the vimentin intermediate filament system. PMID: 23226541
  24. DCN gene can inhibit the growth of nude mice xenograft, which is probably related with the decreased expressions of TGF-beta1 and MMP-9 protein and the inhibition of tumor angiogenesis. PMID: 23046927
  25. Decorin protein core affects the global gene expression profile of the tumor microenvironment in a triple-negative orthotopic breast carcinoma xenograft model. PMID: 23029096
  26. decorin plays a role in tendon viscoelasticity that cannot be completely explained by its role in collagen fibrillogenesis PMID: 22482685
  27. The expression of decorin, a naturally occurring TGF-beta suppressor, was elevated in Mstn-null mice. PMID: 22277753
  28. Decorin regions LRR6 and LRR5 participate in the interaction with LRP-1 and TGF-beta as well as in its dependent signaling. PMID: 22203668
  29. Wild type N-ras appears to mediate its anti-malignant effect by downregulating decorin expression. PMID: 21809347
  30. decorin prevented translational repression of PDCD4 by decreasing the activity of transforming growth factor-beta1 and the abundance of oncogenic miR-21, a translational inhibitor of PDCD4. PMID: 22087031
  31. Cleavage product of decorin serves as a functional receptor of resistin in adipocyte progenitors and may regulate white adipose tissue expansion. PMID: 21683670
  32. gradual increase in muscle regeneration PMID: 21416223
  33. these results implicated a role for decorin in mediating delayed-type hypersensitivity responses by influencing polymorphonuclear leukocyte attachment to the endothelium. PMID: 22043007
  34. Decorin is expressed in placenta/fetal membranes and is developmentally regulated in fetal membranes; data from mutant mouse strains suggest that both decorin and biglycan contribute to gestational success (i.e., prevent premature birth). PMID: 21502335
  35. We show a so far unknown function of decorin and chondroitin-6-sulfate: their ability to inhibit B16V cell migration by intracellular acidification. PMID: 21792923
  36. CTGF specifically induced the synthesis of decorin, suggesting a mechanism of autoregulation. PMID: 21454550
  37. Decorin can modify collagen I-stimulated, but not fibronectin-stimulated myoblast migration in vitro. PMID: 21059388
  38. decorin is a protective agent during the development of diabetic nephropathy PMID: 20083846
  39. Dcn has been identified as an imprinted gene by high-throughput screening using RIKEN cDNA microarray. PMID: 11820791
  40. decorin is dramatically induced in the desmin-null myocardium PMID: 11891192
  41. decorin exerts beneficial effects on tubulointerstitial fibrosis PMID: 11891213
  42. decorin binds fibrinogen in a Zn2+-dependent interaction PMID: 12582160
  43. decorin and biglycan play distinct roles in palatogenesis, and decorin was more actively involved in the process of secondary palate formation than biglycan PMID: 12666199
  44. Inhibition of myoblast migration via decorin expression is critical for normal skeletal muscle differentiation. PMID: 12871697
  45. These alterations in lung tissue mechanical behavior in Dcn-/- mice support a critical role for decorin in the formation of the lung collagen network. PMID: 15447936
  46. in DCN-deficient mice, the growth of corneal vessels was significantly diminished PMID: 15528932
  47. Results describe the effect of bone morphogenetic protein-2 (BMP-2) on the synthesis of proteoglycan during osteogenic conversion of myoblasts and suggest a role for decorin in cell response to BMP-2. PMID: 15920756
  48. decorin is not required for cell survival PMID: 15949467
  49. decorin is required for the proper fibrotic evolution of myocardial infarctions PMID: 15949932
  50. systemic overexpression of decorin reduces inflammation, triglycerides and fibrosis in atherosclerotic plaques of ApoE(-/-) mice resulting in slowing down of disease progression PMID: 16183063
  51. decorin is a potent trophic factor that protects neuronal progenitor cells and glioma cells from oxygen and glucose deprivation PMID: 16467781
  52. Our findings indicate decorin is a key regulatory molecule and that the temporal switch from biglycan to decorin is an important event in the coordinate regulation of fibrillogenesis and tendon development. PMID: 16518859
  53. hevin can modulate the structure of dermal extracellular matrix, specifically by its regulation of decorin levels and collagen fibril assembly PMID: 16844696
  54. LRP-mediated catabolism is a new control pathway for the biological activities of decorin, specifically for its ability to influence extracellular matrix signaling PMID: 16936287
  55. LRP-1-decorin modulatory pathway requires activation of the Smad pathway by TGF-beta and involves phosphatidylinositol 3-kinase activity PMID: 17485468
  56. decorin up-regulated the expression of follistatin, an antagonist of myostatin. PMID: 17597062
  57. Data show that at early stages of fibrillogenesis, the glycosaminoglycan chain of decorin has a reducing effect on collagen fibril diameter. PMID: 17651433
  58. decorin is a natural protective factor against diabetic nephropathy and that the Dcn(-/-) diabetic mouse is a useful new model of progressive diabetic nephropathy. PMID: 17884968
  59. These results clearly show that decorin enhances the proliferation and differentiation of C2C12 myoblasts through suppressing myostatin activity. PMID: 18163379
  60. Data demonstrate that decorin acts as a tumor suppressor gene and plays an important role in the maintenance of cell maturation and therefore homeostasis in the intestinal tract. PMID: 18550571
  61. DCN regulates matrix mineralization by modulating collagen assembly PMID: 19049867
  62. The proangiogenic role of MT1-MMP in the cornea may be mediated, in part, by facilitated cleavage of corneal decorin. PMID: 19571574
  63. a novel role for decorin in the reduction or prevention of tumor metastases in this breast cancer model and could eventually lead to improved therapies for metastatic breast cancer. PMID: 19590249
  64. Decorin gene transfer and neutralization of TGFbeta in cardiac allografts significantly attenuated interstitial fibrosis, cardiac hypertrophy, and improved graft function, but did not result in systemic donor-reactive T cell responses. PMID: 19917705

Show More

Hide All

Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database Links

KEGG: mmu:13179

STRING: 10090.ENSMUSP00000100924

UniGene: Mm.56769

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1