Recombinant Mouse Decorin(Dcn),partial

In Stock
Code CSB-EP006554MOa0
Product Type Recombinant Protein
Size US$2466
Uniprot No. P28654
Lead Time 3-7 business days
Relevance May affect the rate of fibrils formation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GIIPYDPDNPLISMCPYRCQCHLRVVQCSDLGLDKVPWDFPPDTTLLDLQNNKITEIKEGAFKNLKDLHTLILVNNKISKISPEAFKPLVKLERLYLSKNQLKELPEKMPRTLQELRVHENEITKLRKSDFNGLNNVLVIELGGNPLKNSGIENGAFQGLKSLSYIRISDTNITAIPQGLPTSLTEVHLDGNKITKVDAPSLKGLINLSKLGLSFNSITVMENGSLANVPHLRELHLDNNKLLRVPAGLAQHKYIQVVYLHNNNISAVGQNDFCRAGHPSRKASYSAVSLYGNPVRYWEIFPNTFRCVYVRSAIQLGNYK
Research Area Others
Source E.coli
Gene Names Dcn
Protein Names Bone proteoglycan IIPG-S2;PG40
Expression Region 35-354aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 39.9 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May affect the rate of fibrils formation.
Subcellular Location Secreted, extracellular space, extracellular matrix
Protein Families Small leucine-rich proteoglycan (SLRP) family, SLRP class I subfamily
Database Links

KEGG: mmu:13179

STRING: 10090.ENSMUSP00000100924

UniGene: Mm.56769

Pathway TGF-beta signaling pathway

Related Products

Dcn Antibodies

Dcn Antibodies for Mouse

Dcn Proteins

Dcn Proteins for Mus musculus (Mouse)

Dcn ELISA Kit

Dcn ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.