Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Rasd1

Uniprot No.

O35626

Research Area

Others

Species

Mus musculus (Mouse)

Source

Baculovirus

Expression Region

1-280aa

Target Protein Sequence

MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVGSQAKDKERCVIS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.2 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The generation of the recombinant Mouse Rasd1 protein involves manipulating gene expression in baculovirus cells. A specific DNA sequence coding for the Mouse Rasd1 protein (1-280aa) is inserted to an expression vector, which is then introduced into baculovirus cells. The cells that successfully receive the vector are selected and cultured to induce the expression of the desired protein. A N-terminal 10xHis tag is attached to the protein. The recombinant Mouse Rasd1 protein undergoes affinity purification, achieving a purity level exceeding 85%, as verified through SDS-PAGE analysis.

Target Background

Function

Small GTPase. Negatively regulates the transcription regulation activity of the APBB1/FE65-APP complex via its interaction with APBB1/FE65.

Gene References into Functions

These results suggest that Dexras1 is a critical mediator of the IGF-1 signal to activate MAPK, linking glucocorticoid signaling to IGF-1 signaling in adipogenesis. PMID: 27345868
These findings suggest that RASD1 acts as a novel signaling molecule and plays an important role in regulating dynamic uterine remodeling during the estrous cycle in the uterus. PMID: 28188843
This study demonstrated that provide unprecedented evidence for a selective epigenetic up-regulation of Dexras 1 gene expression in the striatum of EAE mice. PMID: 27138096
RASD1 is a novel factor in Metaphase I-Metaphase II oocyte transition and may be involved in regulating the progression of cytokinesis and spindle formation PMID: 27997888
Results suggest a potential role for Dexras1 in modulating a selective subset of psychiatric symptoms, possibly via its interaction with NMDARs and/or other disease-related binding-partners PMID: 26946266
two mechanisms of Rasd1 induction in the hypothalamus, were identified. PMID: 26739966
Lysosomal iron modulates NMDA receptor-mediated excitation via small GTPase, Dexras1 PMID: 27080392
Dexras1 mediates adipogenesis and diet-induced obesity. PMID: 24297897
Dexras1 is involved in the circadian clock regulation PMID: 23703963
Dexras1 appears to mediate N-methylaspartate (NMDA)-elicited neurotoxicity via nitric oxide and iron influx. PMID: 23426685
These results indicate that the absence of Dexras1 sensitizes the suprachiasmatic nucleus to perturbations resulting from restricted feeding. PMID: 22928915
Data suggest that Dexras1 regulates multiple photic and nonphotic signal-transduction pathways, thereby playing an essential role modulating species-specific characteristics of circadian entrainment. PMID: 21834641
Rasd1 modulates endogenous renin gene expression by interacting with Ear2. PMID: 21247419
the Dexamethasone-induced RAS protein 1 (Dexras1) gene is a cycling gene in the suprachiasmatic nucleus PMID: 12573527
Genetic deletion of Dexras1 reduces photic entrainment by eliminating a pertussis-sensitive circadian response to NMDA. Mechanistically, Dexras1 couples NMDA and light input to Gi/o and ERK activation. In PMID: 15339652
dexras1 was found to change rhythmically in hypothalamic and extra-hypothalamic brain regions reaching peak levels early in the light phase. PMID: 16517089
We demonstrate that Rasd1 mRNA is expressed in mouse lymph node cells in response to inhibitory stimuli. Rasd1 mRNA is present at low levels in freshly isol. cells, but it is up-regulated in culture and is expressed in cells whose proliferation is blocked PMID: 17369188

Hide All

Subcellular Location

Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, perinuclear region. Nucleus.

Protein Families

Small GTPase superfamily, RasD family

Tissue Specificity

Expressed in brain, heart, kidney and liver.

Database Links

KEGG: mmu:19416

STRING: 10090.ENSMUSP00000051959

UniGene: Mm.3903

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-BP019354MO(A4)
Abbreviation	Recombinant Mouse Rasd1 protein
MSDS	MSDS Datasheet
Size	$528
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Dexamethasone-induced Ras-related protein 1 (Rasd1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage