Recombinant Mouse Fibroblast growth factor 10 (Fgf10)

Code CSB-MP008616MO
Abbreviation Recombinant Mouse Fgf10 protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Developmental Biology
Alternative Names
Keratinocyte growth factor 2
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
37-209aa
Target Protein Sequence
QALGQDMVSQEATNCSSSSSSFSSPSSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
87.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal HSA-tagged and C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing.
Gene References into Functions
  1. It is concluded that during early pseudoglandular stage of lung development Ptch1 patterns Fgf10 and regulates Foxf1 expression in the lung mesenchyme to direct branch formation and this is essential for proper lobe formation and lung function. PMID: 28939119
  2. small interfering RNA knockdown of FGFR2 suppressed PI3K/Akt pathway activation by FGF10 and abolished its anti-apoptotic and neurite repair effects in vitro. PMID: 28981091
  3. the response of FGF10(+) progenitors and differentiated Airway smooth muscle cells to growth factor treatment in real time using lineage tracing in the background of an air-liquid interface (ALI) culture system. PMID: 28387977
  4. Inactivation of ALX4/Alx4 causes lacrimal gland aplasia in both human and mouse. These results reveal a key role of Alx4 in mediating FGF-Shp2-FGF signaling in the neural crest for lacrimal gland development. PMID: 29028795
  5. show that during homeostasis, basal stem/progenitor cells in cartilaginous airways maintain their stem cell state by downregulating the Hippo pathway (resulting in increased nuclear Yap), which generates a localized Fgf10-expressing stromal niche PMID: 29017029
  6. that miR-205 in the surface ectoderm functions to ensure robust activation of pathways associated with Fgf10 signaling. PMID: 28511845
  7. Mesenchymal FGF10 controls the size of the taste bud papillary area, while overall patterning remains unchanged. Results show that FGF signaling negatively affects the extent of canonical Wnt signaling, which is the main activation pathway during fungiform papillae development; however, this effect does not occur at the level of gene transcription. PMID: 28506989
  8. Sox9 is positively regulated by mesenchymal Fgf10, a process that requires active Erk signaling during salivary gland development PMID: 28506998
  9. Fgf10 is expressed in the mesenchyme around developing submucosal glands. All nasal glands require FGF10 for branching morphogenesis. FGF10 is required for gland budding and ductal morphogenesis of the Steno's gland and the maxillary sinus glands. PMID: 27590203
  10. FGFR2c signaling regulates branching morphogenesis through the activation of FGFR2b signaling via increased FGF10 autocrine. These results provide new insight into the mechanisms by which crosstalk between FGFR2b and FGFR2c results in efficient branching morphogenesis. PMID: 27206683
  11. Decreased Fgf10 mRNA levels lead to congenital lung defects, which are compatible with postnatal survival, but which compromise the ability of the lungs to cope with sub-lethal hyperoxic injury. PMID: 27770432
  12. Fgf10 enhances the formation of tissue-engineered small intestine. PMID: 23468377
  13. Lhx9 expression overlapped markedly with FGF10 expression cells in the limb mesenchyme and was associated with proliferative cells of the progress zone. PMID: 26220830
  14. Hypoplasia of the salivary glands led to a significant reduction in saliva production in Fgf10 heterozygous adult mice PMID: 26321752
  15. Fgf10 signaling has an essential role in the formation of lipofibroblasts during late lung development PMID: 26511927
  16. novel allele of Alx4 results in reduced Fgf10 expression and failure of eyelid fusion in mice PMID: 25673119
  17. regulates regional cardiomyocyte proliferation in the foetal heart through a FOXO3/p27(kip1) pathway PMID: 25344367
  18. Fgf10 alters epithelial cell differentiation in the small intestinal mucosa. PMID: 25721301
  19. Fgf10 plays a dual role in cochlear development: to regulate outgrowth of the duct and subsequently as a bidirectional signal that sequentially specifies Reissners membrane and outer sulcus non-sensory domains. PMID: 25624266
  20. FGF10 has a role in protecting neuron against oxygen-glucose deprivation injury through inducing heme oxygenase-1 PMID: 25446127
  21. A signaling mechanism based on FGF10 and SHH directs outgrowth of the lung bud via a ligand-receptor-based Turing mechanism and a geometry effect in the embryonic mouse. PMID: 25359721
  22. Results thus show how Pbx1 controls Fgf10 in the developing lung. PMID: 24591256
  23. Data identify autocrine activation of FGF signaling as an essential mechanism in promoting Pten-deficient skin tumors. PMID: 24582960
  24. apical ectodermal ridge-Fibroblast growth factors activate sub-apical ectodermal ridge mesenchymal Fgf10 transcription via the downstream Mek-Erk pathway, Etv1, and Ewsr1 in an AGAAAR cluster-dependent manner. PMID: 25109552
  25. FGF10 and FGF2 were identified as stromal ligands that control distinct aspects of mammary ductal branching. PMID: 25078648
  26. FGF10, which was produced from tumor cells, was essential for the proliferation of tumor cell itself and also supports proliferation of endothelial cells. PMID: 24320134
  27. Fgf10-expressing cells represent a pool of mesenchymal progenitors in the embryonic and postnatal lung. PMID: 24353064
  28. Fgf-10 and Fgf-18 are expressed specifically within ventral tanycyte subpopulations. PMID: 23804023
  29. Fgf10 prevents ciliated cell differentiation and promotes basal cell differentiation. PMID: 23924632
  30. inhibition of FGF-10 by inflammatory signaling involves the NF-kappaB-dependent interactions between RELA, SP3, and the Fgf-10 promoter. PMID: 23558680
  31. The sclera of myopic eyes had higher FGF10 levels. The risk G allele of SNP rs339501 was associated with extreme myopia in human and caused a higher gene expression in the luciferase assay. PMID: 23599340
  32. These studies provide direct evidence in support of hypothalamic neurogenesis during late postnatal and adult life, and identify Fgf10(+) tanycytes as a source of parenchymal neurons with putative roles in appetite and energy balance. PMID: 23554498
  33. the FGF10-FGFR2b signaling pathway is not required for epithelial proliferation and differentiation during adult glandular stomach homeostasis PMID: 23133671
  34. Gata3 directly activates Fgf10 in the early inner ear, and does so through a single binding site PMID: 23220102
  35. Fibroblast growth factor 10 gene regulation in the second heart field by Tbx1, Nkx2-5, and Islet1 reveals a genetic switch for down-regulation in the myocardium PMID: 23093675
  36. show that the Fgf10(iCre) line can be used for conditional gene inactivation in an inducible fashion during early developmental stages PMID: 22719891
  37. Results demonstrate that organ fate commitment and progenitor cell expansion are coordinately controlled by the activity of a Sox9/Fgf10/Fgfr2b feed-forward loop in the pancreatic niche. PMID: 22874919
  38. Using tissue specific Fgf9 versus Pitx2 loss of function approaches in the gut epithelium and/or mesenchyme, we determined that FGF9 signals to the mesenchyme via Pitx2 to induce mesenchymal Fgf10 expression, which leads to epithelial cecal bud formation. PMID: 22819677
  39. GAG controls lacrimal gland induction by restricting the diffusion of Fgf10 PMID: 22745308
  40. [review] Preadipocyte proliferation and adipogenesis are greatly impaired in Fgf10 knockout mouse embryos. PMID: 21696361
  41. Functional analysis of Fgf signaling revealed precise reciprocal interactions, which showed that mesenchymal Fgf10 rather than Fgf7 modulates tongue epithelial differentiation via Fgfr2b in a temporal- and spatial-specific manner. PMID: 21720756
  42. deletion of Fgf10 led to absence of the CVP, identifying FGF10 as the first inductive, mesenchyme-derived factor for taste papillae PMID: 21655085
  43. Fgf3 and Fgf10 are not required for specification of cardiovascular progenitors, but rather for their normal developmental coordination. PMID: 21664901
  44. show that Wnt2 signaling is necessary and sufficient for activation of a transcriptional and signaling network critical for smooth muscle specification and differentiation including myocardin/Mrtf-B and the signaling factor Fgf10 PMID: 21704027
  45. Results identify a myocardial to epicardial fibroblast growth factor (FGF) signal, mediated by FGF10 and FGFR2b, that is essential for movement of cardiac fibroblasts into the compact myocardium. PMID: 21750042
  46. FGF-10 induced cardiomyocyte differentiation from ES cells and iPS cells, which may have potential for translation into clinical applications PMID: 21203390
  47. study proposes that Alk5 functions upstream of Fgf10 to regulate transit-amplifying cell proliferation and stem cell maintenance and that this signaling mechanism is crucial for stem cell-mediated tooth regeneration PMID: 21402782
  48. Fgf10-Fgfr2b signaling and lacrimal gland development are controlled by 2-O- and 6-O-sulfated heparan sulfate PMID: 21357686
  49. role of two crucial morphogens, fibroblast growth factor 10 and sonic hedgehog, in the formation of periodically alternating cartilaginous and non-cartilaginous domains in the ventral mesenchyme PMID: 21148187
  50. demonstrate that FGF10-signaling targets include ETS-family transcription factors, which have previously been shown to regulate epithelial maturation and tumor progression PMID: 20883684

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Tissue Specificity
Expressed abundantly in embryos and the lung, and at much lower levels in brain and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*