Recombinant Mouse Fibroblast growth factor 20(Fgf20)

Code CSB-EP008626MO
Size US$2632Purchase it in Cusabio online store
(only available for customers from the US)
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 85% as determined by SDS-PAGE.
Target Names Fgf20
Uniprot No. Q9ESL9
Research Area Cancer
Alternative Names Fgf20Fibroblast growth factor 20; FGF-20
Species Mus musculus (Mouse)
Source E.coli
Expression Region 1-211aa
Target Protein Sequence MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 23.6 kDa
Protein Length Full Length
Tag Info Tag-Free
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Neurotrophic factor that regulates central nervous development and function.
Gene References into Functions
  1. Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID: 25915623
  2. fibroblast growth factor 20 (Fgf20) is expressed in hair placodes and is induced by and functions downstream from epithelial ectodysplasin (Eda)/Edar and Wnt/beta-Catenin signaling to initiate formation of the underlying dermal condensation PMID: 23431057
  3. We hypothesized that Fgf20 plays a role in specification, amplification, or maintenance of Sox2 expression in prosensory progenitors of the developing mammalian cochlea. PMID: 22973011
  4. Fgf20 is a major downstream effector of ectodysplasin and affects ectodysplasin-regulated characteristics of tooth morphogenesis, including the number, size and shape of teeth. PMID: 22833125
  5. The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID: 22698282
  6. Data indicate that the viability and hearing loss in Fgf20 knockout mice suggest that FGF20 may also be a deafness-associated gene in humans. PMID: 22235191
  7. expression of FGF20 in calvarial and limb development PMID: 11900978
  8. Fgf20 is expressed at the right time and place to mediate sensory cell specification and is the likely activator/ligand of fibroblast growth factor (FGF) receptor 1 during cochlear development. PMID: 18524904

Show More

Hide All

Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Database Links

KEGG: mmu:80857

STRING: 10090.ENSMUSP00000034014

UniGene: Mm.425526

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1