Home
Protein
Recombinant Protein
Recombinant Mouse Fibroblast growth factor 20 (Fgf20)

Recombinant Mouse Fibroblast growth factor 20 (Fgf20)

Code	CSB-EP008626MOa0
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Fgf20

Uniprot No.

Q9ESL9

Research Area

Cancer

Alternative Names

Fgf20Fibroblast growth factor 20; FGF-20

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-211aa

Target Protein Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

27.7 kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Neurotrophic factor that regulates central nervous development and function.

Gene References into Functions

Data show that Fibroblast Growth Factors (FGF) 9 and 20 regulate the number of cochlear progenitors. PMID: 25915623
fibroblast growth factor 20 (Fgf20) is expressed in hair placodes and is induced by and functions downstream from epithelial ectodysplasin (Eda)/Edar and Wnt/beta-Catenin signaling to initiate formation of the underlying dermal condensation PMID: 23431057
We hypothesized that Fgf20 plays a role in specification, amplification, or maintenance of Sox2 expression in prosensory progenitors of the developing mammalian cochlea. PMID: 22973011
Fgf20 is a major downstream effector of ectodysplasin and affects ectodysplasin-regulated characteristics of tooth morphogenesis, including the number, size and shape of teeth. PMID: 22833125
The data suggested that, at a minimum, Fgf9/20 and Bmp7 organize the nephron progenitor niche. FGF signaling likely regulates multiple important steps in the niche, including survival, proliferation, and competence. PMID: 22698282
Data indicate that the viability and hearing loss in Fgf20 knockout mice suggest that FGF20 may also be a deafness-associated gene in humans. PMID: 22235191
expression of FGF20 in calvarial and limb development PMID: 11900978
Fgf20 is expressed at the right time and place to mediate sensory cell specification and is the likely activator/ligand of fibroblast growth factor (FGF) receptor 1 during cochlear development. PMID: 18524904