Recombinant Mouse Fibroblast growth factor 7 (Fgf7)

In Stock
Code CSB-MP008634MO
Abbreviation Recombinant Mouse Fgf7 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Heparin-binding growth factor 7;Keratinocyte growth factor
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
32-194aa
Target Protein Sequence
CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
86.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-HSA-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation.
Gene References into Functions
  1. Tregs express kgf. Treg-specific expression of kgf regulates alveolar epithelial proliferation during the resolution phase of acute lung injury and in a model of regenerative alveologenesis in vivo. AT2 cells cocultured with Tregs lacking kgf have decreased rates of proliferation. PMID: 28296468
  2. A role for endogenous KGF in maintenance of normal pulmonary innate immune function. PMID: 26919897
  3. Suppression of miR-219-5p may benefit the liver regeneration and prevent cirrhosis through increasing KGF. PMID: 27855391
  4. we examine how the two presynaptic organizers FGF22 and FGF7 are transported to the appropriate locations so that they act as synapse-type-specific organizing molecules. PMID: 25431136
  5. Exendin-4 increased fibroblast growth factor 7 (Fgf7) expression in colonic polyps of Apc(Min/+) mice. PMID: 25738454
  6. Our observations also point towards PI3K acting as a morphogenic switch for FGF7 signalling. PMID: 25460003
  7. Reverse transcriptase polymerase chain reaction studies showed that three members, Tgfa, Hbegf,and Nrg1 of the EGF family were expressed in the epithelium cultured with FGF7 + LPA as well as in the epithelium freshly isolated from the rudiments. PMID: 24227310
  8. IL-19 is important for cutaneous wound healing because it upregulates KGF expression. PMID: 23582717
  9. FGF7 is downregulated in MED1-deficient mesenchymal cells. FGF7 produced by mesenchymal stromal cells is a novel hematopoietic niche molecule. PMID: 24051090
  10. KGF pretreatment could improve radiation-induced intestinal injury including the epithelial structure and function in a mouse model, as shown by Zo-1 protein and Claudin-1. PMID: 23464848
  11. KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system. PMID: 23554911
  12. Fibroblast growth factor 7 (Fgf7) was identified as a target of miR-143 in murine adipogenesis. PMID: 23247565
  13. FGF7 is a critical regulator of liver progenitor cells PMID: 23322300
  14. Given the specifically targeted effects of FGF-7 on epithelial cells, the authors' findings suggest that further FGF-7-dependent epithelial-mesenchymal interaction exists that may be important in diabetic wound healing. PMID: 22094769
  15. Keratinocyte growth factor gene transduction ameliorates pulmonary fibrosis induced by bleomycin in mice PMID: 21131445
  16. These results suggest that KGF may play an important role in the regulation of VEGF gene expression and angiogenesis during wound healing. PMID: 21672345
  17. KGF promotes preadipocyte proliferation by an autocrine mechanism that involves activation of the PI3K/Akt signaling pathway PMID: 20069574
  18. two members of the fibroblast growth factor (FGF) family, FGF22 and FGF7, promote the organization of excitatory and inhibitory presynaptic terminals, respectively, as target-derived presynaptic organizers PMID: 20505669
  19. keratinocyte growth factor works via an inducible lentivirus to protect bone marrow cells against bleomycin-induced pulmonary fibrosis PMID: 19956603
  20. Protection from thymic epithelial cell injury by keratinocyte growth factor PMID: 12036893
  21. Keratinocyte growth factor preserves normal thymopoiesis and thymic microenvironment during experimental graft-versus-host disease. PMID: 12091365
  22. Following activation by KGF binding, KGF and the KGF receptor remain associated in active complexes through the endocytic pathway, which is described. PMID: 12122441
  23. Stress-induced alterations in cutaneous proinflammatory cytokine and growth factor expression are associated with significant histological changes in healing wounds. PMID: 12161023
  24. gammadelta cell-deficient mice (TCRdelta(-/-)) and KGF-deficient mice (KGF(-/-)) were more prone than wild-type mice to DSS-induced mucosal injury and demonstrated delayed tissue repair after termination of DSS treatment PMID: 12376619
  25. PAK4 interacts with KGF receptor and mediate anti-apoptosis effects of KGF on epithelial cells. PMID: 12529371
  26. In a mouse model of total parenteral nutrition (TPN), application of KGF to TPN mice reversed the decline of proliferation of EC during TPN and prevented the increase in EC apoptosis with TPN alone. PMID: 12592627
  27. KGF-induced Akt activation may play an important role in inhibiting lung alveolar cell death thereby preserving the lung architecture and function during oxidative stress PMID: 12732722
  28. BMP4 and FGF7/FGF10 arrest early T-cell development at the CD4-CD8-CD44+CD25- (double-negative 1 [DN1]) population and at the CD4-CD8- double-negative to CD4+CD8+ double-positive transition in a stromal compartment-dependent manner PMID: 12920023
  29. Structure-based mutational analyses in FGF7 identify new residues involved in specific interaction with FGFR2IIIb. PMID: 14527678
  30. KGF from gamma delta-T cell receptor-expressing intraepithelial lymphocytes is an important factor for maintenance of intestinal epithelial cell proliferation and villus growth. PMID: 15034027
  31. Biological activity of FGF-7 in RAG-1 mice indicates that immuno-dependent mechanisms are not required for the induction of urothelial cell proliferation by this growth factor. PMID: 15176316
  32. epithelial Wnt11, mesenchymal Gdnf and stromal Fgf7 signalling is coordinated by sprouty proteins during kidney development, which regulates ureteric branching PMID: 15201220
  33. KGF antibody abolished the growth promoting effect of GLP-2 in the large intestine, but not in the small intestine PMID: 15544847
  34. KGF appears to be an important growth factor for local resident progenitor epithelial cell repair PMID: 17332441
  35. FGF7 improved survival during acute lung injury in adult mouse lung after short-term expression, but paradoxically induced inflammation and injury after persistent expression. PMID: 17994369
  36. Krt12-rtTA/tet-O-FGF-7 mice may be a suitable animal model for the study of the molecular and cellular mechanisms of human ocular surface squamous neoplasia. PMID: 18276784
  37. Ectopic expression of KGF in acinar cells promotes the expansion of the beta-cell lineage in vivo through activation of the PKB/Akt pathway. PMID: 18372394
  38. p63/p51-induced onset of keratinocyte differentiation via the c-Jun N-terminal kinase pathway is counteracted by keratinocyte growth factor PMID: 18849344
  39. Fgf7 protects against acute lung injury PMID: 17994369

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*