Recombinant Mouse Hyaluronan synthase 2 (Has2), partial

In Stock
Code CSB-EP010140MO
Abbreviation Recombinant Mouse Has2 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Has2
Uniprot No.
Research Area
Others
Alternative Names
Has2; Hyaluronan synthase 2; EC 2.4.1.212; Hyaluronate synthase 2; Hyaluronic acid synthase 2; HA synthase 2
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
67-374aa
Target Protein Sequence
EHRKMKKSLETPIKLNKTVALCIAAYQEDPDYLRKCLQSVKRLTYPGIKVVMVIDGNSDDDLYMMDIFSEVMGRDKSATYIWKNNFHEKGPGETEESHKESSQHVTQLVLSNKSICIMQKWGGKREVMYTAFRALGRSVDYVQVCDSDTMLDPASSVEMVKVLEEDPMVGGVGGDVQILNKYDSWISFLSSVRYWMAFNIERACQSYFGCVQCISGPLGMYRNSLLHEFVEDWYNQEFMGNQCSFGDDRHLTNRVLSLGYATKYTARSKCLTETPIEYLRWLNQQTRWSKSYFREWLYNAMWFHKHHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.9kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. Therefore, it is essential to hyaluronan synthesis a major component of most extracellular matrices that has a structural role in tissues architectures and regulates cell adhesion, migration and differentiation. This is one of the isozymes catalyzing that reaction and it is particularly responsible for the synthesis of high molecular mass hyaluronan. Required for the transition of endocardial cushion cells into mesenchymal cells, a process crucial for heart development. May also play a role in vasculogenesis. High molecular mass hyaluronan also play a role in early contact inhibition a process which stops cell growth when cells come into contact with each other or the extracellular matrix.
Gene References into Functions
  1. allergen-challenged mice that overexpress HAS2 in myofibroblasts and smooth muscle cells develop increased airway fibrosis, which lessens airway hyperresponsiveness to bronchoconstrictors. PMID: 28787175
  2. Expression of the innate immune receptor Toll-like receptor 4 (TLR4) and the extracellular matrix glycosaminoglycan hyaluronan (HA) on type 2 alveolar epithelial cells (AEC@2) are important for AEC2 renewal, repair of lung injury and limiting the extent of fibrosis. Either deletion of TLR4 or HA synthase 2 in surfactant-protein-C-positive AEC2s leads to impaired renewal capacity, severe fibrosis and mortality. PMID: 27694932
  3. Has2 mRNA was expressed in the surrounding mesenchyme from E12.0 to 18.0 in both molar and incisor tooth germs, but disappeared after birth. PMID: 27289075
  4. the ineffective repair of injured cartilage in Has1(-/-) joints can be at least partly explained by the markedly enhanced expression of particular genes in pathways linked to ECM turnover, IL-17/IL-6 cytokine signaling, and apoptosis. PMID: 26521733
  5. these results highlight the role of nSMase2 in apoptosis evoked by nutrient starvation that could contribute to the delayed apoptosis of hypertrophic chondrocytes in the growth plate, and emphasize the antiapoptotic properties of HAS2 PMID: 25555205
  6. mir-23a-3p causes cellular senescence by targeting hyaluronan synthase 2: possible implication for skin aging. PMID: 25264594
  7. Has2 expression and hyaluronan produced at the tips of epithelial cells play a critical role in driving tubulogenesis and branching in vitro. PMID: 25163516
  8. Hyaluronan synthase 2 has a role in protecting skin fibroblasts against apoptosis induced by environmental stress PMID: 25266724
  9. Stimulation with LPS caused rapid increases in versican mRNA and protein, a rapid increase in Has1 mRNA, and concomitant inhibition of hyaluronidases 1 and 2, the major hyaluronan degrading enzymes PMID: 24472738
  10. This study demonistrated that Has2 expression in adult mouse subventricular zone and rostral migratory stream and in ischemic cortex. PMID: 23391595
  11. This study identifies Has2 as a novel downstream target of Shh signaling required for joint patterning and chondrogenesis. PMID: 23313125
  12. HAS2 was significantly upregulated at the level of gene expression during muscle hypertrophy. PMID: 22785117
  13. NSMase2/Cer are the key mediators of the regulation of HA synthesis, via microdomains and the Akt/mTOR pathway PMID: 22383528
  14. Inhibition of Has2 expression and extracellular hyaluronic acid production requires MiR23 in the embryonic heart to restrict endocardial cushion formation. PMID: 21778427
  15. Data show that Has2 knockout mice died near birth and displayed severe abnormality in skeletal development. PMID: 21224752
  16. PDGF-BB stimulates cultured cardiomyocytes to synthesize the extracellular matrix component hyaluronan via HAS2 PMID: 21200430
  17. Data suggest that hyaluronan production by Has2 in chondrocytes is not only essential for formation of an organized growth plate and subsequent long bone growth but also for normal modeling of the diaphyseal bone. PMID: 21246657
  18. hyaluronan synthase 2 activity is regulated by dimerization and ubiquitination PMID: 20507985
  19. Expression of the mouse HAS2 gene in Drosophila tissues by the Gal4/UAS system resulted in massive HA accumulation in the extracellular space,supporting the idea that in vivo HA biosynthesis does not require molecules other than the HAS protein PMID: 14966127
  20. Has2 expression was impaired in oocyte-cumulus cell complexes in knockout mice. PMID: 15531364
  21. strongly, albeit transiently, expressed in numerous embryonic tissues PMID: 15765504
  22. natural antisense mRNAs of HAS2 may have an important and novel regulatory role in the control of HAS2, hyaluronan biosynthesis, and HA-dependent cell functions PMID: 15843373
  23. Has2 deficiency illustrates the crucial role of hyaluronan in skeletal growth, patterning, chondrocyte maturation and synovial joint formation in the developing limb. PMID: 19633173
  24. Tbx2, a central intermediary of Bmp-Smad signaling, has a central part in directing Has2 and Tgfbeta2 expression, facilitating endocardial cushions formation. PMID: 19846762

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
NodC/HAS family
Tissue Specificity
Expressed in heart, brain, spleen, lung and skeletal muscle.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*