Recombinant Mouse Insulin-like growth factor II (Igf2)

In Stock
Code CSB-EP011088MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Igf2
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Igf2; Igf-2Insulin-like growth factor II; IGF-II; Multiplication-stimulating polypeptide) [Cleaved into: Insulin-like growth factor II; Preptin]
Species
Mus musculus(Mouse)
Source
E.coli
Expression Region
25-91aa
Target Protein Sequence
AYGPGETLCGGELVDTLQFVCSDRGFYFSRPSSRANRRSRGIVEECCFRSCDLALLETYCATPAKSE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
13.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Power up your signal transduction research with our Recombinant Mouse Igf2, also known as Insulin-like growth factor II. This protein, expressed in E.coli, is a crucial component in studies of growth regulation, cell survival, and cellular communication.

Our Igf2 is the full length of the mature protein (25-91aa), offering a complete representation of its structure and function. The protein is expressed with a N-terminal 6xHis-tag, ensuring efficient purification and optimal stability. With a purity exceeding 85% as determined by SDS-PAGE, our Recombinant Mouse Igf2 meets the highest standards for precision in scientific research. Choose between a liquid form for immediate experimentation or a lyophilized powder for extended stability, tailoring your research to new heights.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development (Probable). IGF2 is influenced by placental lactogen (Probable). Also involved in tissue differentiation (Probable). In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable). Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate.; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.
Gene References into Functions
  1. Myogenesis-associated long noncoding rna promotes myogenesis by functioning as a competing endogenous RNA for microRNA-125b to control protein abundance of IGF2. PMID: 28281528
  2. DIS3L2 loss of function results in transcriptional activation of the Igf2/H19 locus in nephron progenitor cells, most likely by leading to the activation of shared cis-regulatory elements that control these genes. PMID: 29950491
  3. the effect of ZBED6 on growth of muscle and internal organs is mediated through the binding site in the Igf2 gene PMID: 29440408
  4. Rapamycin-independent IGF2 expression in Tsc2-null mouse embryo fibroblasts and human lymphangioleiomyomatosis cells. PMID: 29758070
  5. IGF2 is silenced in mouse embryos by the zinc finger protein ZFP568 PMID: 28522536
  6. These findings indicate that IGF-II reduces PGC-1alpha expression in skeletal muscle cells through a mechanism involving PI3K-Akt-FoxO1 but not p38 MAPK or Erk1/2 MAPK pathways. PMID: 28374141
  7. produced by pericentral hepatocytes to promote hepatocyte proliferation and repair tissue damage in the setting of chronic liver injury PMID: 28653763
  8. Here the authors show that fibroblast growth factor 22 (FGF22), a target-derived presynaptic organizer in the mouse hippocampus, induces the expression of insulin-like growth factor 2 (IGF2) for the stabilization of presynaptic terminals. PMID: 27083047
  9. Loss of Igf2 Gene Imprinting is associated with Prostate Cancer. PMID: 28775169
  10. IGF2 controls bone growth by regulating glucose metabolism in chondrocytes. PMID: 28974642
  11. These results demonstrate that overexpressed IGF-2 is the major tumorigenic driver in a subset of CRCs and encourage testing of MEDI-573, alone and in combinations, in IGF2-overexpressing CRC patients. PMID: 27399333
  12. Our study reveals that the expression level of Igf2 is critical to maintain the balance between stem cell self-renewal and differentiation, presumably by regulating the interaction between HSC and their niche. PMID: 28007480
  13. analysis of the distal muscle enhancer in the mouse Igf2 locus PMID: 26645089
  14. Data indicate that the effects of insulin-like growth factor 2 (IGF2) are mediated by direct upregulation of the cyclin-dependent kinase inhibitor p57 (p57). PMID: 26872540
  15. Mstn may negatively regulate Igf2 expression to control postnatal skeletal muscle growth, however differences in growth between male and female mice are not readily explained by changes in expression of Igf family members. PMID: 26198127
  16. Study provides evidence for regulation of Igf2 by microRNAs and further elucidates the role of miR141-3p and miR-200a-3p in the mouse placental development. PMID: 26247408
  17. IGF2 contributes to neural stem cell maintenance in subventricular zone but not in the subgranular zone, and this is regulated by the biallelic expression of IGF2 in the vascular compartment. PMID: 26369386
  18. results uncovered a distinctive pro-IGF-II-mediated self-reinforcement mechanism of muscle regeneration PMID: 25917344
  19. Data (including data from studies in knockout mice) suggest that, in aging and metabolic stress such as insulin resistance/pregnancy, pancreatic beta-cells exhibit sex differences in expression of Igf2 during beta-cell expansion/mass adaptation. PMID: 26384384
  20. case of Balb/3T3 the concentration of IGF2 in culture supernatants decreased after 1 and 5 mM and increased after 10 mM of metformin. metformin influences the cytophysiology of somatic cells causing inhibition of proliferation PMID: 26064951
  21. ZBED6 inhibits IGF2 activity. PMID: 24691566
  22. Insulator activity of the H19/Igf2 imprinting control region varies by cell type and may depend on cell-specific enhancers as well as posttranslational modifications of the insulator protein CTCF. PMID: 24990148
  23. upregulation of IGF2/Igf2 is likely controlled by hypermethylation of H19 DMR1 in human NTDs, however, in acute external RA-induced NTD mice it is potentially determined by more open chromatin structure PMID: 25423083
  24. Data indicate that hedgehog (Hh) signaling activated the expression of insulin-like growth factor 2 (Igf2) that during osteoblast differentiation. PMID: 25825734
  25. Data show that adeno-associated virus AAV8-mediated expression of insulin-like growth factor 2 (IGF2) reverses both memory and dendritic spine density impairments. PMID: 25100745
  26. These results potentially indicate that IGF2 may mediate vascular smooth muscle cells calcification via the stimulation of Erk1/2 and Akt signalling. PMID: 24482492
  27. Insulin-like growth factor-2 enhances functions of antigen (Ag)-specific regulatory B cells. PMID: 24811165
  28. it was PDGF, NT-3 and IGF-2 in combination that conducted the transdifferentiation PMID: 24454677
  29. The down-regulation of Igf2 and Peg3 imprinted genes in adipocytes may be involved in the paternal transmission of high-fat diet-induced obesity. PMID: 24416415
  30. IGF-2 expression is elevated in enterocytes and is required for the hyperplastic intestinal mucosal phenotype of retinoblastoma protein (Rb) knockout mice. Findings reveal novel regulatory roles for Rb in expanding intestinal mucosal surface area. PMID: 23845628
  31. Mice engineered to be null for the placenta-specific P0 transcript (insulin-like growth factor-2-P0 knockout) reveal a role for the placenta in long-term programming of emotional behaviour. PMID: 23921428
  32. The aim of this study was to characterize the ocular morphology of low-density lipoprotein receptor-deficient apolipoprotein B-100-only mice, with IGF-II overexpression. PMID: 23922490
  33. show that expression of IGF2R protein was reduced to less than 50% overall in tissues previously known to be Igf2 growth dependent. This occurred despite the detection of mouse derived peptides PMID: 23468951
  34. This work reveals the fundamental importance of IGF-II in the mature podocyte for glomerular health across mammalian species. PMID: 23299523
  35. Beta cell regeneration in adult mice depends on re-expression of IGF-II. PMID: 22970135
  36. mTOR regulates organismal growth by promoting IGF2 production in the mouse embryo through mTORC2-catalyzed cotranslational IMP1/IMP3 phosphorylation PMID: 23388827
  37. a link between the mechanisms for maintenance of the unmethylated state of the H19/Igf2 ICR and the undifferentiated cell-specific induction of DNA demethylation. PMID: 23115243
  38. IGF-II isoforms possess unique biological properties that may enable them to escape normal sequestration avenues and remain bioavailable in vivo to sustain oncogenic signaling PMID: 23166326
  39. The growth factor IGF2 is a mild contributor to malignant adrenocortical tumourigenesis. PMID: 22952916
  40. These results provide the first in vivo evidence that a myogenic regulator together with a growth factor act simultaneously but through independent pathways to repress Prdm16, which opens potential therapeutic perspectives for human metabolic disorders. PMID: 22859371
  41. a persistent infection of a thymic epithelial cell line with enteroviruses like CV-B4 E2 can result in a disturbed production of IGF-2, a protein involved in central self-tolerance toward islet beta cells. PMID: 22855493
  42. The Igf2 decreased specifically in the central nucleus of the amygdala after chronic immobilization stress. PMID: 22672618
  43. The authors observed Igf2 genetic dependency of the p53 null phenotype during embryonic development and tumour formation. PMID: 22674894
  44. These data indicate that the effects of Pten loss at heterozygote levels commonly observed in human tumours are modified by Igf2 ligand, and emphasise the importance of the evaluation of upstream pathways in tumours with Pten loss. PMID: 22120709
  45. Data show that both Akt1-/- and Igf2-/- mice exhibited decreased placental weight, fetal weight and viability. PMID: 22562201
  46. IGF-IR-mediated activation of intracellular signaling may play a critical role during oxidative stress-induced apoptosis in necrotizing enterocolitis. PMID: 22434232
  47. This study illustrated a fundamental role of IKK/NF-kappaB-Igf2-Igf2R signaling in synapse formation and maturation in adult mice. PMID: 22514330
  48. System A activity and vascular function in the placental-specific Igf2 knockout mouse. PMID: 21851977
  49. fear extinction-induced IGF2/IGFBP7 signalling promotes the survival of 17-19-day-old newborn hippocampal neurons PMID: 21873981
  50. observed that deletion of placental-specific transcript of IGF-II prevented up-regulation of amino acid transfer normally seen in undernourished wild-type placenta PMID: 21673101

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Insulin family
Tissue Specificity
Expressed in the heart, blood serum, kidney and skeletal muscle including the tibialis anterior muscle.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*