Recombinant Mouse Insulin-like growth factor-binding protein 7 (Igfbp7)

In Stock
Code CSB-MP713980MO
Abbreviation Recombinant Mouse Igfbp7 protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
26-281aa
Target Protein Sequence
SSSDACGPCVPASCPALPRLGCPLGETRDACGCCPVCARGEGEPCGGGAAGRGHCAPGMECVKSRKRRKGKAGAAAGGPATLAVCVCKSRYPVCGSNGITYPSGCQLRAASLRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAKVFLSCEVIGIPTPVLIWNKVKRDHSGVQRTELLPGDRENLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASAAAKITVVDALHEIPLKKGEGAQL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.3 kDa
Protein Length
Full Length
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds IGF-I and IGF-II with a relatively low affinity Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.
Gene References into Functions
  1. Our findings define an immune component of the pleiotropic mechanisms through which IGFBP7 suppresses hepatocellular carcinoma PMID: 28619711
  2. Study shows that IGFBP7 contributes significantly to mesenchymal stromal cells (MSC)-mediated immune modulation, as is shown by decreasing ability of IGFBP7 knockdown in MSCs to restore proliferation and cytokine production in T-cells. PMID: 27397633
  3. data suggest that IGFBP-7 was up regulated during EAE and inhibit the transition from OPCs to mature OLs, implying its use as a potential therapeutic target for the treatment of inflammatory demyelinating diseases PMID: 25819415
  4. Our data suggest that loss of Igfbp7 induces precocious involution possibly through diminished cell survival signals. PMID: 24505323
  5. Angiomodulin is necessary for cardiac commitment of embryonic stem cells (ESCs) and its regulation depends on TAp63 isoform. PMID: 24145187
  6. a model whereby IGFBP7 binds to unoccupied IGF1R and suppresses downstream signaling, thereby inhibiting protein synthesis, cell growth, and survival. PMID: 23250396
  7. IGFBP7 has a novel role in mouse uterus: it is regulating uterine receptivity through Th1/Th2 lymphocyte balance and decidualization. PMID: 23028860
  8. fear extinction-induced IGF2/IGFBP7 signalling promotes the survival of 17-19-day-old newborn hippocampal neurons PMID: 21873981
  9. Results demonstrate that the vascular-specific marker angiomodulin (AGM) modulates vascular remodeling in part by temporizing the proangiogenic effects of VEGF-A. PMID: 19542015
  10. study showed that IGFBP-rP1 (IGFBP7) was expressed in dysregulated podocytes in a human immunodeficiency virus-associated nephropathy model and in immature podocytes in the developing kidney; conclude that IGFBP-rP1 may be a product of injured podocytes PMID: 20630940
  11. Mac25 interacts with the extracellular matrix proteins and glycosaminoglycans that are expressed in most blood vessels including high endothelial venules, as well as with chemokines implicated in regulation of lymphocyte trafficking, e.g., SLC and IP-10. PMID: 12847218
  12. Proteolytic processing of mac25 modulates its insulin/IGF-1-dependent growth-stimulatory activity. PMID: 14521955
  13. IGFBP-7 can regulate glioma cell migration through the AKT-ERK pathway, thereby playing an important role in glioma growth and migration PMID: 19048112

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Expressed at high levels in lung, kidney, small intestine, testis and uterus and at moderate levels in liver.
Database Links

KEGG: mmu:29817

UniGene: Mm.233470

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*