Recombinant Mouse Intercellular adhesion molecule 4(Icam4),partial

Code CSB-EP880644MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q9ERM2
Relevance Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias CD_antigen: CD242
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS
Research Area Others
Source E.coli
Gene Names Icam4
Expression Region 23-231aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.1kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.
Subcellular Location Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted
Protein Families Immunoglobulin superfamily, ICAM family
Database Links

KEGG: mmu:78369

STRING: 10090.ENSMUSP00000001040

UniGene: Mm.30220

Related Products

Icam4 Antibodies

Icam4 Antibodies for Mus musculus (Mouse)

Icam4 Proteins

Icam4 Proteins for Mus musculus (Mouse)

Icam4 ELISA Kit

Icam4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.