Recombinant Mouse Intercellular adhesion molecule 4 (Icam4), partial

In Stock
Code CSB-EP880644MO
Abbreviation Recombinant Mouse Icam4 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Icam4
Uniprot No.
Research Area
Others
Alternative Names
Icam4; Intercellular adhesion molecule 4; ICAM-4; CD antigen CD242
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
23-231aa
Target Protein Sequence
QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.1kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 23-231 constitute the expression domain of recombinant Mouse Icam4. The theoretical molecular weight of the Icam4 protein is 39.1 kDa. This Icam4 recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of Icam4, making it easier to detect and purify the Icam4 recombinant protein in the later stages of expression and purification.

The main functions of the mouse Intercellular Adhesion Molecule 4 (Icam4) lie in its role as a cell adhesion molecule primarily expressed in erythroid cells. Icam4 is implicated in cellular interactions and adhesion processes, particularly during erythroblast maturation. By participating in cell-cell adhesion, Icam4 likely contributes to the regulation of hematopoietic and immune system functions. Its involvement in erythroid cell development suggests a role in the formation and maturation of red blood cells.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Isoform 2 may modulate binding of membrane-associated ICAM4.
Gene References into Functions
  1. A novel second splice cDNA encodes an ICAM-4 isoform lacking the membrane-spanning domain. Erythroblasts express both isoforms. This new isoform, ICAM-4S, may modulate membrane-associated ICAM-4 binding & regulate erythroblast molecular attachments. PMID: 12406883
  2. ICAM-4 is critical in erythroblastic island formation via ICAM-4/alpha(V) adhesion PMID: 16690966
Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Secreted.
Protein Families
Immunoglobulin superfamily, ICAM family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*