Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Ifi204

Uniprot No.

P0DOV2

Research Area

Others

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

216-417aa

Target Protein Sequence

QNIPRGAVLHSEPLTVMVLTATDPFEYESPEHEVKNMLHATVATVSQYFHVKVFNINLKEKFTKKNFIIISNYFESKGILEINETSSVLEAAPDQMIEVPNSIIRNANASPKICDIQKGTSGAVFYGVFTLHKKTVNRKNTIYEIKDGSGSIEVVGSGKWHNINCKEGDKLHLFCFHLKTIDRQPKLVCGEHSFIKISKRGN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

24.2 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The generation of the recombinant Mouse Ifi204 protein involves transfecting Yeast cells with a DNA expression vector carrying the gene for the protein of interest (216-417aa). After transfection, the cells are cultured to express the desired protein. The protein is fused with a C-terminal 6xHis tag. The recombinant Mouse Ifi204 protein is collected and purified from the cell lysate through affinity purification, attaining a purity greater than 90%, as determined by SDS-PAGE.

Target Background

Function

Interferon-stimulated protein that plays a role in several biological processes including cell differentiation, autophagy and innate immunity. Cooperates with CGAS to sense dsDNA and activates the STING-dependent type I IFN pathway. Mechanistically, gets acteylated upon bacterial infection and then translocates from nucleus into cytoplasm to recruit STING for activation of TBK1-dependent IRF3 nuclear translocation and IFN-beta release. Inhibits the transcription of ribosomal RNA. May inhibit DNA binding by UBTF. Inhibits cell growth via p53/TP53 and RB1-dependent and independent pathways. Acts as a coactivator of RUNX2 during osteogenesis. May be involved in macrophage differentiation. Enables skeletal muscle and cardiac myocyte differentiation by sequestring Id proteins in the cytosol and promoting their ubiquitination and subsequent degradation.

Gene References into Functions

p204 is a critical component of canonical LPS-TLR4 signaling pathway, and these studies also suggest that p204 could be a potential target to prevent and treat inflammatory and infectious diseases. PMID: 29472103
Importantly, knocking down p204, which is reported as the mouse orthologous of human IFI16, inhibited epidermal hyperplasia in mice with imiquimod-induced psoriasiform dermatitis. These findings indicate that IFI16 plays a critical role in the pathogenesis of psoriasis and may be a potential therapeutic target PMID: 27137868
Ifi204 is required for EPC differentiation. PMID: 27514835
study identifies the AIM2 inflammasome and cGAS/IFI16-STING-type I IFN pathway as a novel mechanism for host innate immunity to the ALVAC vaccine vector. PMID: 28947539
p204 initiated innate antiviral responses in adipose cells, thereby modulating adipocyte function. PMID: 25287442
cGAS and Ifi204 cooperate to produce type I IFNs in response to Francisella infection. PMID: 25710914
The present study demonstrated that mouse Leydig cells had innate antiviral activities in response to viral DNA challenge through p204 activation. PMID: 24876405
confers resistance to HSV-1 infection in the corneal epithelium PMID: 22236996
Data indicate that the transient expression of p204 in the early stage is indispensable for adipocyte differentiation. Disruption of p204 expression patterns at this stage leads to irreversible damage in fat formation. PMID: 20444940
IFI16 exerts in vivo anti-tumoral activity by promoting apoptosis of tumor cells. PMID: 19553003
acquires malignant transformation capability upon mutation at the Rb-binding sites PMID: 11943193
This gene product interacts with the Tpr protein, a component of the nuclear pore complex. PMID: 12513910
p204 synergizes with pRb in the stimulation of Cbfa1-dependent gene activation and osteoblast differentiation PMID: 17439944
Ifi204 is a regulator of monocyte/macrophage differentiation and make possible a connection with other myeloid regulators [review] PMID: 17981596
p204, a murine member of the p200 family regulates cell proliferation, cell and tissue differentiation (e.g. of skeletal muscle myotubes, beating cardiac myocytes, osteoblasts, chondrocytes and macrophages) and signaling by Ras proteins[review] PMID: 19027346

Hide All

Subcellular Location

Nucleus. Nucleus, nucleolus. Cytoplasm.

Protein Families

HIN-200 family

Tissue Specificity

Present in osteoblasts (at protein level).

Database Links

KEGG: mmu:15951

UniGene: Mm.261270

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-YP322750MO
Abbreviation	Recombinant Mouse Ifi204 protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Interferon-activable protein 204 (Ifi204), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage