Recombinant Mouse Interleukin-21 receptor (Il21r), partial (Active)

In Stock
Code CSB-MP864315MO
Abbreviation Recombinant Mouse Il21r protein, partial (Active)
MSDS
Size $98
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Il21r at 2 μg/ml can bind Mouse Il21 (CSB-MP887666MO1). The EC50 is 6.858-8.187 ng/mL. Biological Activity Assay
  • Activity
    Mouse Il21 (CSB-MP887666MO1) captured on Protein A Chip can bind Recombinant Mouse Il21r with an affinity constant of 0.146 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
  • The purity of Il21r was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Mouse Il21r at 2 μg/mL can bind Mouse Il21 (CSB-MP887666MO1). The EC50 is 6.858-8.187 ng/mL.
②Mouse Il21 (CSB-MP887666MO1) captured on Protein A Chip can bind Recombinant Mouse Il21r with an affinity constant of 0.146 nM as detected by MetaSPR Assay (WeSPRTM 200).
Target Names
Uniprot No.
Alternative Names
Interleukin-21 receptor; IL-21 receptor; IL-21R; Lymphocyte receptor beta; LR-beta; Novel cytokine receptor 8; NR8; Novel interleukin receptor; CD antigen CD360
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
20-236aa
Target Protein Sequence
CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
Mol. Weight
26.6 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a receptor for interleukin-21.
Gene References into Functions
  1. In mice, IL-21:IL-21R interactions influence the phenotype of T follicular cells, reducing the expression of CXCR4 and inhibiting the expansion of Tfr cells after T-cell-dependent immunization. The negative effect of IL-21 on Tfr cells in mice is cell intrinsic and associated with decreased expression of the high affinity IL-2 receptor (CD25). PMID: 28303891
  2. IL21R signal my contribute to anti-adenine nucleotide translocator antibody production and expansion of B cells in viral myocarditis PMID: 28550395
  3. this study shows that IL-21R signaling is essential for the optimal control of Mycobacterium tuberculosis infection PMID: 28855309
  4. natural genetic variation in murine Il21r influences neuronal cell viability after ischemia by modulating receptor function and downstream signal transduction PMID: 27400126
  5. IL-21 may play an important role in the pathogenesis of SSc as a Th17 effector cytokine, and IL-21 may induce the differentiation of Th17 cells in the BLM-induced systemic sclerosis mouse model via Il21R. PMID: 25545680
  6. Gene expression analyses of angioimmunoblastic T-cell lymphoma (AITL), showed that essentially all cases expressed elevated levels of transcripts for IL21, IL21R, and a series of genes associated with TFH cell development and function. PMID: 26363366
  7. IIl21r deletion reduced spontaneous EAE associated with defective Th17 cell generation. IL-21R deficiency limited IL-23R expression on Th17 cells and inhibited expression of key molecules for pathogenic Th17 cell generation. PMID: 26413871
  8. our data demonstrate the novel finding that the IL-21R plays a critical role in regulating innate immune responses against HSV-2 infection. PMID: 24358128
  9. During experimental arthritis, IL-21R deficiency protected against severe inflammation and joint destruction. This was accompanied by suppressed serum IgG1 levels and antigen-specific T cell responses. PMID: 24757141
  10. in the absence of IL-21/IL-21R signaling, Il2(-/-) mice retained a deficiency in Tregs yet exhibited a reduced and delayed inflammatory disease which was reflected in reduced pancreatitis and hemolytic anemia PMID: 24446516
  11. IL-21R expression on donor CD4+ T cells is essential for sustaining T cell number and help for B cells, resulting in more severe lupus-like renal disease, but it does not alter the balance of T helper (Th)17 cells and regulatory T cells. PMID: 22723520
  12. IL-21R controls both antigen transport by DCs and the crucial beacon function of CD4(+) cells for autoreactive CD8(+) cells to reach the islets. PMID: 22579473
  13. Data indicate that CD8KO recipients given either C57Bl/6 or IL-21RKO CD8+ cells showed the recipients given C57Bl/6 CD8+ cells with significantly greater myocarditis than recipients of IL-21RKO CD8+ cells. PMID: 22465422
  14. IL-21 and IL-2 can have overlapping roles in promoting conventional T-cell responses but play distinct roles in controlling Treg homeostasis and function. PMID: 22442347
  15. study demonstrated T-extrafollicular helper cells are dependent on IL-21R for their generation; study highlighted that IL-21R signaling is necessary for the spontaneous accumulation of multiple B and T cell effector populations in MRLlpr mice PMID: 22231702
  16. IL-21R KO and wild-type donor T cells showed equivalent alloactivation, but IL-21R KO T cells showed decreased infiltration and inflammatory cytokine production within the mesenteric lymph nodes. PMID: 21596854
  17. Following secondary immunization of IL-21 receptor knockout mice, IgG antibody responses to hapten-onjugated chicken gamma globulin are significantly impaired, identifying the IL-21 pathway as a critical component of the memory B cell response. PMID: 21169545
  18. Recipients of donor CD4-positive T cells lacking IL-21 receptor exhibit diminished graft-versus-host disease symptoms, with reduced inflammatory cell infiltration into the liver and intestine, leading to prolonged survival PMID: 20574002
  19. Germinal center reactions and B cell responses induced by immunization with virus-like particles are strongly reduced in both global and B cell-specific IL-21 receptor-deficient mice. PMID: 20368279
  20. Increased IL-21 and IL-21R expression may be involved in the development of experimental autoimmune uveitis, possibly by promoting IL-17 secretion. PMID: 20057909
  21. The common gamma chain (gamma c) is a required signaling component and supports IL-21-induced cell proliferation via JAK3 PMID: 12093291
  22. IL-21 plays a crucial role in supporting polarized Th2 responses in vivo, while appearing superfluous for Th1 and Th17 responses PMID: 17077330
  23. provides preliminary evidence for a role of IL-21 in modulating the severity of systemic lupus erythematosus in BXSB-Yaa mice PMID: 17911475
  24. data demonstrate that the absence of IL-21 or IL-21R does not critically influence FoxP3+ Treg and Th17 cell differentiation, organ recruitment, and associated inflammatory diseases in models of CNS and heart autoimmunity PMID: 18546146
  25. These results suggest an important role for IL-21R in the mobilization of skin dendritic cells to draining lymph nodes and the subsequent allergic response to epicutaneously introduced antigen. PMID: 19075398
  26. IL-21 arising from an abnormal population of CD4 T cells is thus central to the development of SLE, and, more generally, could play an important role in human SLE and related autoimmune disorders. PMID: 19164519
  27. endogenous IL-21/IL-21R is not required for NK, NKT, and CD8(+) T cell-mediated tumor immunity PMID: 19915059
  28. The IL-21 receptor is a target for the therapy of fibrosis and diseases asssociated with chronic Th2 cytokine responses, including liver cirrhosis and asthma. PMID: 16778988

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type I cytokine receptor family, Type 4 subfamily
Tissue Specificity
Selectively expressed in lymphoid tissues. Most highly expressed in thymus and spleen.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*