Recombinant Mouse Interleukin-23 subunit alpha(Il23a),partial

Code CSB-EP863641MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q9EQ14
Abbreviation Il23a
Relevance Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Short name: IL-23 subunit alpha Short name: IL-23-A Alternative name(s): Interleukin-23 subunit p19 Short name: IL-23p19
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA
Research Area Immunology
Source E.coli
Gene Names Il23a
Protein Names Recommended name: Interleukin-23 subunit alpha Short name= IL-23 subunit alpha Short name= IL-23-A Alternative name(s): Interleukin-23 subunit p19 Short name= IL-23p19
Expression Region 22-196
Tag Info N-terminal 6xHis-tagged
Mol. Weight 23.7kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Subcellular Location Secreted
Protein Families IL-6 superfamily
Tissue Specificity Secreted by activated dendritic cells (at protein level). Detected in various tissues with higher expression in polarized Th1 cells and activated macrophages.
Database Links

KEGG: mmu:83430

STRING: 10090.ENSMUSP00000026449

UniGene: Mm.125482

Pathway Jak-STAT signaling pathway
Th17 cell differentiation

Related Products

Il23a Antibodies

Il23a Antibodies for Mus musculus (Mouse)

Il23a Proteins

Il23a Proteins for Mus musculus (Mouse)

Il23a ELISA Kit

Il23a ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.