Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4MO). The EC₅₀ is 5.260-6.497 ng/mL.

Target Names

Ly6g6d

Uniprot No.

Q9Z1Q3

Research Area

Cell Biology

Alternative Names

Ng25

Species

Mus musculus (Mouse)

Source

Yeast

Expression Region

20-108aa

Target Protein Sequence

HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN

Mol. Weight

11.1 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d/Ng25) belongs to the Ly-6 superfamily of GPI-anchored proteins implicated in immune cell signaling and lymphocyte activation, yet its precise functional roles remain an active area of investigation. This recombinant protein, spanning the full mature sequence (aa 20–108) and expressed in yeast with an N-terminal 6xHis tag, demonstrates specific antibody binding in functional ELISA with an EC50 of 5.260–6.497 ng/mL when immobilized at 2 μg/mL, providing quantitative evidence that supports its use in antibody screening, epitope mapping studies, and as a positive control in Ly6g6d detection assays. The protein meets the purity and endotoxin criteria typical for immunological binding assays, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, making it appropriate for applications requiring low background interference. Researchers investigating Ly-6 family member interactions or developing Ly6g6d-targeted reagents will find this validated reagent suitable for establishing baseline binding kinetics and assay development workflows.

Target Background

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.

Tissue Specificity

Expressed in embryonic tissue and adult lung, kidney, brain, liver and spleen.

Database Links

KEGG: mmu:114654

UniGene: Mm.246697

Code	CSB-YP4973MO
Abbreviation	Recombinant Mouse Ly6g6d protein (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC₅₀ is 5.260-6.497 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

Product Details

Customer Reviews and Q&A

Target Background

×CloseMessage