Recombinant Mouse Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)

In Stock
Code CSB-YP4973MO
Abbreviation Recombinant Mouse Ly6g6d protein (Active)
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4HU). The EC50 is 5.260-6.497 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse Ly6g6d at 2 μg/ml can bind Anti-Ly6g6d recombinant antibody (CSB-RA013246MA4MO). The EC50 is 5.260-6.497 ng/mL.
Target Names
Uniprot No.
Research Area
Cell Biology
Alternative Names
Ng25
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
20-108aa
Target Protein Sequence
HRTRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
Mol. Weight
11.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d/Ng25) belongs to the Ly-6 superfamily of GPI-anchored proteins implicated in immune cell signaling and lymphocyte activation, yet its precise functional roles remain an active area of investigation. This recombinant protein, spanning the full mature sequence (aa 20–108) and expressed in yeast with an N-terminal 6xHis tag, demonstrates specific antibody binding in functional ELISA with an EC50 of 5.260–6.497 ng/mL when immobilized at 2 μg/mL, providing quantitative evidence that supports its use in antibody screening, epitope mapping studies, and as a positive control in Ly6g6d detection assays. The protein meets the purity and endotoxin criteria typical for immunological binding assays, with >95% purity by SDS-PAGE and <1.0 EU/μg endotoxin, making it appropriate for applications requiring low background interference. Researchers investigating Ly-6 family member interactions or developing Ly6g6d-targeted reagents will find this validated reagent suitable for establishing baseline binding kinetics and assay development workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Cell projection, filopodium.
Tissue Specificity
Expressed in embryonic tissue and adult lung, kidney, brain, liver and spleen.
Database Links

KEGG: mmu:114654

UniGene: Mm.246697

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*