Recombinant Mouse Major urinary protein 6(Mup6)

Code CSB-EP360881MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P02762
Relevance Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias Alpha-2U-globulin Group 1, BS6 Allergen: Mus m 1
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
Research Area Others
Source E.coli
Gene Names Mup6
Protein Names Recommended name: Major urinary protein 6 Short name= MUP 6 Alternative name(s): Alpha-2U-globulin Group 1, BS6 Allergen= Mus m 1
Expression Region 1-180aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 36.6kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of females.
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity Abundant in the urine of adult male mice but absent from that of females.
Database Links

KEGG: mmu:100038948

STRING: 10090.ENSMUSP00000092661

UniGene: Mm.335875

Related Products

Mup6 Antibodies

Mup6 Antibodies for Mouse

Mup6 Proteins

Mup6 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.