Recombinant Mouse Mesothelin (Msln), partial

Code CSB-EP015044MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Msln
Uniprot No.
Alternative Names
Msln; Mes; Mpf; Mesothelin; Pre-pro-megakaryocyte-potentiating factor) [Cleaved into: Megakaryocyte-potentiating factor; MPF); Mesothelin; cleaved form]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
298-600aa
Target Protein Sequence
DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGTMLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYPESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLKVSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGDIPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQRHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASVKDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQKLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLGLGLQGGIPNGYLVLDFNVREAFS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
50.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Does this protein CSB-EP015044MO can be used in ELISA assay?

A:
Very nice to receive your inquiry.
We have used this protein as immunogen and performed indirect ELISA, but the customer needs to explore the specific conditions themselves.

Target Background

Function
Membrane-anchored forms may play a role in cellular adhesion.; Megakaryocyte-potentiating factor (MPF) may potentiate megakaryocyte colony formation.
Gene References into Functions
  1. our findings show that Sulf-1 is an important tumor suppressor gene in hepatocellular carcinoma (HCC), and its over expression downregulates Msln and results in a decrease in HCC cell proliferation, migration, invasion, and lymphatic metastasis. PMID: 27626699
  2. Mesothelin/mucin 16 signaling in activated portal fibroblasts regulates cholestatic liver fibrosis.( PMID: 28287406
  3. Results show that mouse mesothelin is similar to human mesothelin. Its stable overexpression in a pancreatic cancer cell line did not increase cell proliferation, suggesting that mesothelin is not necessarily a tumor progression factor. PMID: 26931187
  4. MSLN has an important role in the growth of lung cancer cells in vivo raising the possibility that inactivation of MPF may be a useful treatment for lung and other MSLN expressing cancers. PMID: 25118887
  5. The mesothelin expression promotes resistance to certain chemotherapy drugs such as TNF-alpha, paclitaxel, and a combination of platinum and cyclophosphamide. PMID: 22721387
  6. Mesothelin overexpression promotes mesothelioma cell invasion and MMP-9 secretion. PMID: 22371455
  7. Data show that mesothelin is a potential target in reducing resistance to cytotoxic drugs, and mesothelin-treated cells revealed rapid tyrosine phosphorylation of the p85 subunit of PI3K. PMID: 19747165
  8. binding of membrane-bound mesothelin to ovarian cancer antigen CA125 mediates heterotypic cell adhesion PMID: 14676194

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Golgi apparatus.; [Megakaryocyte-potentiating factor]: Secreted.
Protein Families
Mesothelin family
Tissue Specificity
Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*