Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Map1lc3b

Uniprot No.

Q9CQV6

Research Area

Cancer

Alternative Names

Autophagy-related protein LC3 B;Autophagy-related ubiquitin-like modifier LC3 B;MAP1 light chain 3-like protein 2;MAP1A/MAP1B light chain 3 B;MAP1A/MAP1B LC3 B;Microtubule-associated protein 1 light chain 3 beta

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

2-120aa

Target Protein Sequence

PSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

20.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. In response to cellular stress and upon mitochondria fission, binds C-18 ceramides and anchors autophagolysosomes to outer mitochondrial membranes to eliminate damaged mitochondria. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.

Gene References into Functions

Data show that interaction between miR-471-5p and autophagy member proteins regulates clearance of apoptotic germ cells via LC3-associated phagocytosis (LAP). PMID: 28928467
The crystal structure of mouse LC3B in complex with the FYCO1 LC3-interacting region (LIR) reveals the importance of the flanking region of the LIR motif. PMID: 28291748
Data suggest that maternal nutrition modulates expression of autophagy proteins p62/Sqstm1 and Lc3-II/Map1lc3 in liver and hypothalamus of offspring (newborn, suckling, and adult stages); for example, high-fat diet leading to maternal obesity up-regulates p62 and down-regulates Lc3-II in neonatal liver. (p62/Sqstm1 = sequestosome 1; Lc3-II/Map1lc3 = microtubule-associated protein 1-light chain 3) PMID: 27180121
Treatment of aged mice and their derived macrophages with methyltransferase inhibitor (2)-epigallocatechin-3-gallate (EGCG) or specific DNA methyltransferase 2 (DNMT2) siRNA restored the expression of Atg5 and LC3 in vivo and in vitro. PMID: 26909551
MREG-dependent processing links both autophagic and phagocytic processes in LC3-associated phagocytosis. MREG participates in coordinating the association of phagosomes with LC3 for content degradation with the MREG loss leading to phagosome accumulation. PMID: 25301234
This work identifies a previously unrecognized role for alphav and the autophagy components LC3 and atg5 in regulating TLR signalling and B-cell immunity. PMID: 26965188
Deficiency of autophagy protein Map1-LC3b mediates IL-17-dependent lung pathology during respiratory viral infection via ER stress-associated IL-1. PMID: 25669150
This study suggests that autophagy could play a role in placental invasion system and that nutrient starvation affects LC3B expression. PMID: 25421500
Data indicate that the recombinant plasmid encoding pCMV-LC3-LpqH could be a practical strategy for the development of improved vaccines against Mycobacterium tuberculosis. PMID: 24909277
p62/LC3b complex regulates lung alveolar epithelial cell homeostasis and cytoprotection after hyperoxia. PMID: 23333919
Lc3 over-expression improves survival and attenuates lung injury through increasing autophagosomal clearance in septic mice. PMID: 22968077
LC3B plays a regulatory role in hyperoxia-induced epithelial apoptosis PMID: 22095627
The model and biochemical data provide a rationale for Atg7 dimerization: Atg8 is transferred in trans from the catalytic cysteine of one Atg7 protomer to Atg3 bound to the N-terminal domain of the opposite Atg7 protomer within the homodimer. PMID: 22055190
The results suggest that autophagic protein LC3B exerts a protective function during the pathogenesis of pulmonary hypertension PMID: 20889906
a mechanism by which LC3B, through interactions with Cav-1 and Fas, can regulate apoptosis. PMID: 20956295
MAP1B is involved in the initial stages of axonogenesis, as shown by reduced axon length and increased growth cone size of cultured dorsal root ganglion neurons from MAP1B deficient mice. PMID: 12088839
Results suggest novel compensatory mechanisms for loss of LC3beta, ensuring proper FN accumulation and autophagy during fetal and neonatal life. PMID: 18069693

Hide All

Subcellular Location

Cytoplasm, cytoskeleton. Endomembrane system; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane; Lipid-anchor.

Protein Families

ATG8 family

Database Links

KEGG: mmu:67443

STRING: 10090.ENSMUSP00000034270

UniGene: Mm.28357

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP861453MO
Abbreviation	Recombinant Mouse Map1lc3b protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage