Recombinant Mouse Midkine(Mdk)

Code CSB-MP013624MO
Abbreviation Recombinant Mouse Mdk protein
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Retanoic acid-responsive protein;Retinoic acid-induced differentiation factor
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
23-140aa
Target Protein Sequence
KKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
81.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal HSA-tagged and C-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Secreted protein that functions as cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Binds cell-surface proteoglycan receptors via their chondroitin sulfate (CS) groups. Thereby regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration. Participates in inflammatory processes by exerting two different activities. Firstly, mediates neutrophils and macrophages recruitment to the sites of inflammation both by direct action by cooperating namely with ITGB2 via LRP1 and by inducing chemokine expression. This inflammation can be accompanied by epithelial cell survival and smooth muscle cell migration after renal and vessel damage, respectively. Secondly, suppresses the development of tolerogenic dendric cells thereby inhibiting the differentiation of regulatory T cells and also promote T cell expansion through NFAT signaling and Th1 cell differentiation. Promotes tissue regeneration after injury or trauma. After heart damage negatively regulates the recruitment of inflammatory cells and mediates cell survival through activation of anti-apoptotic signaling pathways via MAPKs and AKT pathways through the activation of angiogenesis. Also facilitates liver regeneration as well as bone repair by recruiting macrophage at trauma site and by promoting cartilage development by facilitating chondrocyte differentiation. Plays a role in brain by promoting neural precursor cells survival and growth through interaction with heparan sulfate proteoglycans. Binds PTPRZ1 and promotes neuronal migration and embryonic neurons survival. Binds SDC3 or GPC2 and mediates neurite outgrowth and cell adhesion. Binds chondroitin sulfate E and heparin leading to inhibition of neuronal cell adhesion induced by binding with GPC2. Binds CSPG5 and promotes elongation of oligodendroglial precursor-like cells. Also binds ITGA6:ITGB1 complex; this interaction mediates MDK-induced neurite outgrowth. Binds LRP1; promotes neuronal survival. Binds ITGA4:ITGB1 complex; this interaction mediates MDK-induced osteoblast cells migration through PXN phosphorylation. Binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase, and the induction of cell proliferation. Promotes epithelial to mesenchymal transition through interaction with NOTCH2. During arteriogenesis, plays a role in vascular endothelial cell proliferation by inducing VEGFA expression and release which in turn induces nitric oxide synthase expression. Moreover activates vasodilation through nitric oxide synthase activation. Negatively regulates bone formation in response to mechanical load by inhibiting Wnt/beta-catenin signaling in osteoblasts. In addition plays a role in hippocampal development, working memory, auditory response, early fetal adrenal gland development and the female reproductive system.
Gene References into Functions
  1. leukocyte domiciled midkine mediates increased plasma levels of VEGFA relevant for upregulation of endothelial nitric oxide synthase 1 and 3 PMID: 29233575
  2. Study demonstrates that regulation of astroglial responses to lipopolysaccharide administration are highly dependent on the levels of expression of pleiotrophin and midkine. PMID: 29061398
  3. MDK functions in the ventral tegmental area to limit ethanol consumption and levels of CCL2 PMID: 28398003
  4. It may be involved in the regeneration of acinar cells in acute pancreatitis. PMID: 27992669
  5. Analyses of the melanoma secretome and validation in clinical specimens showed that the heparin-binding factor midkine is a systemic inducer of neo-lymphangiogenesis that defines patient prognosis. This role of midkine was linked to a paracrine activation of the mTOR pathway in lymphatic endothelial cells. PMID: 28658220
  6. MK limits amphetamine-induced striatal neuroinflammation PMID: 28044069
  7. MK serves an indispensable role in the NFAT-regulated activation of CD4(+) T cells and Th1 cell differentiation. PMID: 28183532
  8. Ethanol engages MDK (and ALK) signaling, which has important consequences for alcohol-induced neurotoxicity. PMID: 26206265
  9. Mdk plays a crucial role in the early inflammation phase and during the development of cartilaginous callus in the fracture healing process. PMID: 25551381
  10. MK-deficient mice produced higher amounts of epoxyeicosatrienoic acids (EETs), and EETs dominantly regulated blood pressure in these mice. PMID: 25377079
  11. This study demonistrated that a differential regulation of specific behavioural responses to ethanol by midkine. PMID: 25149366
  12. clonidine-induced analgesia was significantly enhanced in PTN-/- mice compared to MK-/- and WT+/+ mice in the tail-immersion test PMID: 23891830
  13. MK did not lead to an inflammatory activation of neutrophils suggesting that it does not serve as classical proinflammatory cytokine. PMID: 24458438
  14. midkine plays a critical role in cardiac hypertrophy and remodelling. PMID: 24291499
  15. Midkine exerts a neuroprotective role against amphetamine-induced neurotoxicity in striatum. PMID: 23459167
  16. MK leads to a blockade of PAI-1, which is closely associated with the suppression of crescentic glomerulonephritis. PMID: 23201132
  17. Soluble rhMDK, rmMDK and rhPTN were expressed at a high-level and the protein was purified by a one-step purification using heparin affinity chromatography. Activity of purified rhMDK and rhPTN was confirmed by a cell proliferation assay. PMID: 22871361
  18. Findings indicate a critical role for the midkine-Notch2 signaling axis in neuroblastoma tumorigenesis, which implicates new strategies to treat neuroblastoma. PMID: 23243020
  19. This study concluded that MEK is essential for acquisition of gliogenic competence by radial progenitors and that levels of MEK activity regulate gliogenesis in the developing cortex. PMID: 22998872
  20. Identify endothelial cells as the source of soluble midkine in the vascular system during hypoxia and defined midkine as a pivotal player of angiogenesis during ischemia in nonmalignant tissue. PMID: 22707563
  21. identify significant differences between PTN and MK in the control of pain processing at the spinal level, and support the hypothesis that inhibitors of the PTN/MK signaling pathway could potentiate opioid analgesia PMID: 22342918
  22. Midkine knock-out mice display pronounced impairments in their olfactory discrimination ability and short-term social recognition memory with no gross motor alterations. PMID: 21301897
  23. midkine aggravates experimental autoimmune encephalomyelitis by suppressing tolerogenic dendritic cell development, thereby impairing the regulatory CD4(+)CD25(+)Foxp3(+) T cell population PMID: 22323540
  24. data demonstrate that Mdk-deficiency in mice has an anabolic effect on mechanically induced cortical bone formation PMID: 21185956
  25. It is a growth factor which plays a role in pathogenesis of neoplasms and inflammations and is a neuroprotectant in case of nerve injuries. (review) PMID: 21089377
  26. Mdk deficiency, at least in mice, results in an increased trabecular bone formation. PMID: 20200993
  27. Midkine promotes self-renewal and proliferation of mouse embryonic stem cells. PMID: 20442752
  28. Neuroprotective effect of midkine gene transfer persisted until the subacute phase of brain infarction. Midkine may contribute to neuronal regeneration. These results suggest the usefulness of midkine gene transfer for treatment of brain infarction. PMID: 19535098
  29. A lack of MK following sciatic nerve injury is a critical factor in degeneration and regeneration. PMID: 19437545
  30. Antisense oligodeoxynucleotide targeted to Midkine, a heparin-binding growth factor, suppresses tumorigenicity of mouse rectal carcinoma cells. PMID: 11731432
  31. midkine binds to ALK and has a role in signal transduction for cell growth and survival PMID: 12122009
  32. midkine expression is associated with postnatal lung development, but not necessarily with hyperoxic cell damage. PMID: 12207052
  33. Midkine expression in nephrogenesis and its role in ischaemic reperfusion injury. MK induces chemotaxis of inflammatory leukocytes into the tubulointerstitium and contributes to aggravation of ischaemia-induced tubulointerstitial damage. PMID: 12386288
  34. MK staining in the respiratory epithelial cells correlated with sites of expression of thyroid transcription factor (TTF) -1, a transcription factor regulating formation and gene expression in the lung parenchyma. PMID: 12761850
  35. Pleiotrophin and Midkine are differently expressed and distributed during retinoic acid-induced neural differentiation PMID: 14708942
  36. nuclear targeting growth factor midkine undergoes proteasomal degradation PMID: 14970216
  37. MK participates in each of the two distinct phases of rheumatoid arthritis development, namely, migration of inflammatory leukocytes and osteoclast differentiation, and is a key molecule in the pathogenesis PMID: 15146411
  38. Midkine is regulated by hypoxia and causes pulmonary vascular remodeling PMID: 15197188
  39. midkine has a role in susceptibility to cisplatin-induced renal damage PMID: 15509530
  40. Midkine antisense phosphorothioate oligodeoxyribonucleotide reduced ischemia reperfusion injury to kidney epithelium. PMID: 15780085
  41. MK may play a role in epithelium-mesenchyme interactions, blood vessel signaling, and the decision of proliferation vs differentiation. PMID: 15823575
  42. These data support potentially high levels importance of MK and the MK/PTN developmental gene family in downstream signals initiated by angiotensin II. PMID: 15979460
  43. midkine regulates pleiotrophin gene expression with a high degree of organ specificity, suggesting that pleiotrophin gene expression follows midkine gene expression in development PMID: 15985215
  44. MK together with pleiotrophin are very important regulators of the catecholamine pathway in mouse aorta and may critically regulate catecholamine biosynthesis. PMID: 16643958
  45. Left ventricular fractional shortening 24 hours after ischemia/reperfusion injury in midkine (Mdk)-deficient mice is significantly less than that in Mdk-expressing wild-type mice. PMID: 17015789
  46. Female infertility in mice may result from deficiency in Mdk. PMID: 17121547
  47. Midkine-STAT3 signaling pathway plays a necessary role in mitotic clonal expansion and differentiation. PMID: 17204554
  48. High glucose upregulated Midkine expression in primary-cultured tubular epithelial cells of streptozotocin-induced diabetic mice with diabetic nephropathy. PMID: 17607302
  49. Glucocorticoid receptor-null lungs included p21 CIP1 (decreased 2.9-fold, P < 0.05), a negative regulator of the cell cycle, and Mdk (increased 6.0-fold, P < 0.05), a lung growth factor. PMID: 17901120
  50. Deficiency in midkine (MK), a heparin-binding growth factor involved in oncogenesis, inflammation, and tissue repair, attenuated experimental autoimmune encephalomyelitis (EAE) because of an expansion of the Treg cell population in peripheral lymph nodes. PMID: 18319343

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Pleiotrophin family
Tissue Specificity
Expressed in the follicular epithelium and granulosa cells of the ovary.
Database Links

KEGG: mmu:17242

STRING: 10090.ENSMUSP00000028672

UniGene: Mm.906

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*