Recombinant Mouse Neural retina-specific leucine zipper protein (Nrl)

In Stock
Code CSB-EP016086MO
Abbreviation Recombinant Mouse Nrl protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Nrl
Uniprot No.
Research Area
Others
Alternative Names
Nrl; Neural retina-specific leucine zipper protein; NRL
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-237aa
Target Protein Sequence
MAFPPSPLAMEYVNDFDLMKFEIKREPSEGRSGVPTASLGSTPYSSVPPSPTFSEPGMVGGGEAPRPGLEELYWLATLQQQLGSDEVLGLSPDEAVELLQNQGPVSMEGPLGYYSGSPGETGAQHVQLPERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSGGPGSDDHTHLFL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.1 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a transcriptional activator which regulates the expression of several rod-specific genes, including RHO and PDE6B. Functions also as a transcriptional coactivator, stimulating transcription mediated by the transcription factor CRX and NR2E3. Binds in a sequence-specific manner to the rhodopsin promoter.
Gene References into Functions
  1. that two photoreceptor-specific transcription factors, NRL and CRX, are master regulators of this program and are required for tumor maintenance in this subgroup PMID: 29533784
  2. Following Nrl disruption, rods gain partial features of cones and present with improved survival in the presence of mutations in rod-specific genes, consequently preventing secondary cone degeneration. In three different mouse models of retinal degeneration, the treatment substantially improves rod survival and preserves cone function. PMID: 28291770
  3. Nrl is posttranscriptionally regulated to facilitate the generation of other cell types in retina PMID: 27878762
  4. De novo assembly and alternative splicing analyses revealed previously unannotated rod-enriched transcripts and the role of NRL in transcript maturation. PMID: 27880916
  5. Our studies reveal coregulation of coding and noncoding transcripts in rod photoreceptors by NRL and establish the framework for deciphering the function of ncRNAs during retinal development. PMID: 28863214
  6. To explore dendritic stratification of OFF bipolar cells in the absence of rods, we made use of the 'cone-full' Nrl-/- mouse retina in which all photoreceptor precursor cells commit to a cone fate including those which would have become rods in wild-type retinas PMID: 28257490
  7. CNGA3 expression restored cone function in in CNGA3-/-/Nrl-/- mice, an all-cone model of CNGA3 achromatopsia. PMID: 25855802
  8. REEP6.1 is a key functional target of NRL-centered transcriptional regulatory network in rod photoreceptors. PMID: 24691551
  9. Data indicate that positive feedback between neural retina leucine zipper factor (NRL) and retinoid-related orphan receptor beta gene (Rorb) genes reinforces the commitment to a rod differentiation fate. PMID: 25296752
  10. shRNA-mediated knockdown of Crx and Nrl resulted in reduced Kcnv2 promoter activity and low endogenous Kcnv2 mRNA expression in the retina. PMID: 24664678
  11. This study analyzed the retinal pigment epithelium from Nrl(-/-) mice of various ages for lipofuscin fluorescence and A2E levels. PMID: 22417141
  12. Findings suggest that elimination of Nrl in adult rods may represent a unique therapy for retinal degeneration. PMID: 23319618
  13. Our results show that NRL and CRX together control the expression of most, if not all, genes involved in rod phototransduction through a cis-regulatory module PMID: 22511886
  14. found that Nrl activated rhodopsin and Ppp2r5c transcription by recruiting Tip60 to promote histone H3/H4 acetylation PMID: 22354990
  15. Nrl as a direct transcriptional target of RORbeta and suggest that combinatorial action of multiple regulatory factors modulates the expression of Nrl in developing and mature retina. PMID: 21673114
  16. Nrl-deficient retina may serve as a model for elucidating mechanisms of cone homeostasis and degeneration that would be relevant to understanding diseases of the cone-dominant human macula. PMID: 22238088
  17. a model in which Nrl expression is primarily initiated by OTX2 and RORbeta and later maintained at high levels by CRX and RORbeta. PMID: 21865162
  18. Cone-like outer segment phagocytosis in Nrl(-/-) mice shows a similar profile to that of rods in normal mice and other species. PMID: 21203345
  19. results suggest that Ppp2r5c expression is regulated by Nrl during retinogenesis through direct binding to the promoter region of Ppp2r5c PMID: 21078119
  20. Studies suggest an important role of sumoylation in fine-tuning the activity of NRL and thereby incorporating yet another layer of control in gene regulatory networks involved in photoreceptor development and homeostasis. PMID: 20551322
  21. the function of NRL is modulated by its interaction with specific repressor proteins, related to cross-talk between signaling pathways in the retina PMID: 12566383
  22. both Nrl and Crx are required for full transcriptional activity of the PDE6A gene PMID: 15001570
  23. a 2.5-kb Nrl promoter segment directs the expression of enhanced GFP specifically to rod photoreceptors and the pineal gland PMID: 16505381
  24. NRL is not only essential but is sufficient for rod differentiation PMID: 17242361
  25. Nrl and Grk1 have roles in photoresponse recovery and age-related degeneration PMID: 17249566
  26. Rorbeta directs rod development and does so in part by inducing the Nrl-mediated pathway of rod differentiation. PMID: 19805139

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus.
Protein Families
BZIP family
Tissue Specificity
Expressed in the retina (at protein level).
Database Links
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*