Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Nmes1

Uniprot No.

Q810Q5

Research Area

Others

Alternative Names

Nmes1Normal mucosa of esophagus-specific gene 1 protein

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-83aa

Target Protein Sequence

MGVFQILMKNKELIPLAFFISVAATGATSFALYALKKTDVVIDRKRNPEPWEMVDPTQPQKLITINQQWKPVEELQKVRRATR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

25.6kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-83 form the expressed segment for recombinant Mouse Nmes1. The theoretical molecular weight of the Nmes1 protein is 25.6 kDa. Expression of this Nmes1 protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the Nmes1 encoding gene fragment was conducted, allowing for easier detection and purification of the Nmes1 protein in subsequent stages.

Mouse normal mucosa of esophagus-specific gene 1 protein (Nmes1) plays a crucial role in cellular differentiation and tissue homeostasis. Its primary function involves contributing to the maintenance of normal esophageal mucosal integrity. In molecular biology, Nmes1 is implicated in regulating gene expression patterns associated with tissue specificity. Exploring Nmes1 provides insights into esophageal biology, cellular differentiation, and potential implications in gastrointestinal research. Additionally, Nmes1's role in tissue homeostasis suggests relevance in understanding epithelial integrity in various organs. Investigating Nmes1 offers avenues for research in molecular and cellular biology, potentially enhancing the understanding of tissue-specific gene regulation and contributing to advancements in gastroenterology.

Target Background

Subcellular Location

Nucleus.

Protein Families

Complex I NDUFA4 subunit family

Tissue Specificity

Strongly expressed in vertebrae, brain, intestine and stomach.

Database Links

KEGG: mmu:433470

STRING: 10090.ENSMUSP00000040781

UniGene: Mm.36783

Code	CSB-EP770515MO
Abbreviation	Recombinant Mouse Nmes1 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Normal mucosa of esophagus-specific gene 1 protein (Nmes1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage