Recombinant Mouse Phospholipase A-2-activating protein (Plaa), partial

Code CSB-EP018107MO1
Abbreviation Recombinant Mouse Plaa protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Plaa; Plap; Phospholipase A-2-activating protein; PLA2P; PLAP
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
495-584aa
Target Protein Sequence
TGAGRYMPGSAGMDTTMTGVDPFTGNSAYRSAASKTVNIYFPKKEALTFDQANPTQILGKLKELNGTAPEEKKLTEDDLVLLEKILSLIC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
14.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Mouse Plaa recombinant protein was produced in E.coli, where the gene sequence encoding Mouse Plaa (495-584aa) was expressed with the N-terminal 10xHis tag and C-terminal Myc tag. The purity of this Plaa protein was greater than 85% by SDS-PAGE.
Plaa is an enzyme activation protein, and its primary function is to activate Phospholipase A-2 (PLA2) inside cells, promoting the hydrolysis of membrane phospholipids, resulting in the production of free fatty acids and phospholipids. This reaction plays a crucial role in the metabolism of cell membranes, signal transduction, and inflammatory responses. Plaa is typically expressed in various tissues and cell types, including the brain, heart, liver, lungs, and kidneys. Its main role is to control the metabolism of membrane phospholipids by activating PLA2, maintaining the integrity of cell membranes, and participating in cell signal transduction.
As an activator protein for PLA2, Plaa may play a role in inflammatory responses and disease processes, including lipid-mediated inflammation and cell membrane rupture. The Phospholipase A-2 (PLA2) family of proteins is of significant importance in medical research due to their associations with various diseases, such as inflammatory diseases, neurological disorders, and cancer. Plaa, as an activator of PLA2, may have potential implications in the research and treatment of related diseases.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in protein ubiquitination, sorting and degradation through its association with VCP. Involved in ubiquitin-mediated membrane proteins trafficking to late endosomes in an ESCRT-dependent manner, and hence plays a role in synaptic vesicle recycling. May play a role in macroautophagy, regulating for instance the clearance of damaged lysosomes. Plays a role in cerebellar Purkinje cell development. Positively regulates cytosolic and calcium-independent phospholipase A2 activities in a tumor necrosis factor alpha (TNF-alpha)- or lipopolysaccharide (LPS)-dependent manner, and hence prostaglandin E2 biosynthesis.
Gene References into Functions
  1. We demonstrate that PLAA is essential for neural function, through dual roles of (1) regulating post-endocytic trafficking of signaling receptors necessary for neural development and (2) directing sorting of synaptic vesicle (SV) components during recycling, essential for synaptic function. PMID: 28413018
  2. miR-203 may regulate expression of the novel nociceptive mediator PLAA after incision. PMID: 22846677
  3. Phospholipase A2 activating protein is required for 1alpha,25-dihydroxyvitamin D3 dependent rapid activation of protein kinase C via Pdia3 PMID: 22484374
Subcellular Location
Nucleus. Cytoplasm. Cell junction, synapse.
Protein Families
WD repeat PLAP family
Tissue Specificity
Expressed in the brain, with highest levels in hippocampal neurons, cerebellar granular cell layer and Purkinje cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*