Recombinant Mouse Platelet-derived growth factor subunit B (Pdgfb)

Code CSB-YP017709MO
Abbreviation Recombinant Mouse Pdgfb protein
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
PDGF-2;Platelet-derived growth factor B chain;Platelet-derived growth factor beta polypeptide;Proto-oncogene c-Sis
Species
Mus musculus (Mouse)
Source
Yeast
Expression Region
82-190aa
Target Protein Sequence
SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
13.7 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. Potent mitogen for cells of mesenchymal origin. Required for normal proliferation and recruitment of pericytes and vascular smooth muscle cells in the central nervous system, skin, lung, heart and placenta. Required for normal blood vessel development, and for normal development of kidney glomeruli. Plays an important role in wound healing. Signaling is modulated by the formation of heterodimers with PDGFA.
Gene References into Functions
  1. microRNA let-7g suppresses PDGF-induced conversion of vascular smooth muscle cell into the atherosclerotic phenotype. PMID: 28699690
  2. The PDGFB-overexpressing murine tumors closely cluster with human proneural and mesenchymal subtypes, as well as PDGFRA-amplified at both the RNA and protein expression levels. These models can be generated in fully immunocompetent mixed or C57BL/6 genetic background mice, and therefore can easily be incorporated into preclinical studies for cancer cell-specific or immune cell-targeting drug discovery studies. PMID: 28836293
  3. Myeloid cell-derived PDGF contributes to vascular neotissue formation by regulating macrophage apoptosis, smooth muscle cell proliferation and extracellular matrix deposition. PMID: 28524773
  4. These results demonstrate the requirement of lymphatic endothelial cells-autonomous PDGFB expression and retention for smooth muscle cell recruitment to lymphatic vessels. PMID: 28851707
  5. Mechanical strain stimulates vasculogenesis of embryonic stem cells by the intracellular messengers ROS, NO and calcium as well as by upregulation of angiogenesis guidance molecules and the angiogenic growth factors VEGF, FGF-2 and PDGF-BB. PMID: 27725190
  6. PDGF-B-PDGFRbeta signaling plays a significant role in the development of adipose tissue neovascularization. PMID: 28122789
  7. data suggest that the stronger fibrotic effect generated by Pdgfa overexpression was mediated by Pdgfralpha in cardiac interstitial mesenchymal cells PMID: 27816607
  8. loss-of-function mutations in PDGFB or PDGFRB cause Primary Familial Brain Calcification. PMID: 26599395
  9. High PDGFB expression is associated with liver fibrosis. PMID: 24801603
  10. Increased expression of STAT5b + PDGFB led to increased expression of downstream STAT5b targets. PMID: 25302990
  11. Platelets produce PDGFB to activate stellate cells and promote fibrosis in MDR2-null mice. PMID: 25173753
  12. The endogenous levels of PDGF-BB, increases CD31(hi)endomucin(hi) vessel number and stimulates bone formation in ovariectomy mice. PMID: 25282358
  13. These findings thus implicate a novel role of PDGF-BB in the migration of pericytes, resulting in loss of pericyte coverage from the endothelium with a subsequent breach of the blood-brain barrier PMID: 25164676
  14. The signaling pathways of VEGF and PDGF are crucial mediators for determining proliferation of endothelial cells and oligodendrocytes in the neurohypophysis of adult mice. PMID: 24860149
  15. Our findings demonstrate, for the first time, that Shh is involved in PDGF-BB-induced smooth muscle cell migration and recruitment of mural cells into neovessels PMID: 24472833
  16. Tumor PDGF-BB expression levels determine dual effects of anti-PDGF drugs on vascular remodelling and metastasis. PMID: 23831851
  17. Mutations in the gene encoding PDGF-B cause brain calcifications in humans and mice. PMID: 23913003
  18. endothelium, via Dll4 and PDGF-BB, induces a fate switch in adjacent skeletal myoblasts PMID: 23477786
  19. Development of the retina is severely disturbed in transgenic mice in which PDGF-B was over-expressed . PMID: 22880002
  20. PDGF-B signaling in trophoblasts was identified as a key component of the unique placental hematopoietic microenvironment that protects hematopoietic stem cells from premature differentiation. PMID: 22387002
  21. define a previously unidentified mechanism of PDGF-BB-induced tumor angiogenesis and provide compelling evidence for the key role of EPO in mediating PDGF-BB-induced angiogenesis, tumor growth and hematopoiesis PMID: 22138754
  22. TGFbeta and PDGF-B have important roles in modulating myofibroblast generation in the mouse cornea after haze-associated injury. PMID: 21978952
  23. PDGF-BB induces ASM hyperplasia and changes in lung mechanics in mice PMID: 21216974
  24. this is the first study to connect PDGF-B-induced changes in hepatic sinusoidal transport to changes in insulin action, demonstrating a link between PDGF-B signaling and insulin sensitivity. PMID: 21673305
  25. Data show that PDGF-B depletion by RNAi caused GICs to lose their tumor-initiating capacity. PMID: 21677873
  26. PDGF-BB stimulates cultured cardiomyocytes to synthesize the extracellular matrix component hyaluronan via HAS2 PMID: 21200430
  27. Overexpression of platelet-derived growth factor-B accelerates liver cancer development in chemically induced liver carcinogenesis. PMID: 20506153
  28. PDGF-B-driven gliomagenesis can occur in the absence of the proteoglycan NG2 PMID: 20939912
  29. a tightly regulated expression of PDGF during embryogenesis is required for normal brain development and function in mice. PMID: 20643125
  30. PDGF has a role in induction of the synaptic plasticity gene Arc/Arg3.1 PMID: 20452974
  31. The COL1A1-PDGFB fusion gene is the most characteristic cytogenic anomaly in DFSP. PMID: 20133221
  32. study to examine the potential role of PDGF-B in an experimental model of peritoneal fibrosis PMID: 19896531
  33. results show that osteoclasts regulate osteoblasts directly and suggest that PDGF BB is a key factor in bone remodeling PMID: 11811556
  34. PDGF-B chain transformation of NIH3T3 cells requires activation of NF-kappaB PMID: 11855867
  35. endothelium-restricted ablation of PDGF-B generates viable mice with variation in the density of pericytes throughout the CNS; data suggest that a reduction of the pericyte density is sufficient to cause retinopathy in mice PMID: 12169633
  36. Blockade transiently delays but does not prevent fibrous cap formation in ApoE null mice PMID: 12368212
  37. PDGF is an important effector molecule in postnatal retinal development. PMID: 12528182
  38. retention of PDGF-B in microvessels is essential for proper recruitment and organization of pericytes and for renal and retinal function in adult mice PMID: 12897053
  39. Endothelial and nonendothelial sources of PDGF-B regulate pericyte recruitment and influence vascular pattern formation in tumors. PMID: 14561699
  40. PDGF-BB stimulation of fibroblast-collagen interactions is mediated by the alphavbeta3 integrin when beta1 integrin function is impaired. PMID: 14644167
  41. In vitro cultures supporting the spontaneous generation of functional cardiac myocytes from murine BMCs demonstrated induced expression of PDGF)-A and -B. PDGF-AB enhances the generation of BMC-derived cardiac myocytes in mouse hearts. PMID: 14963008
  42. Imatinib reduces PDGFB by treating the atherosclerosis or by an autocrine loop linking PDGF signal transduction to PDGF expression. PDGF plays a central role in the complex interplay of cytokines & growth factors leading to a vicious circle. PMID: 14988091
  43. expression and potential role of platelet-derived growth factor-BB (PDGF-BB) and its receptor, PDGF receptor beta (PDGFR-beta), during testis cord formation PMID: 14996938
  44. PDGF-B provides a key switch from cell death to survival induced by TNF PMID: 15735680
  45. syngenic mice deficient of PDGF-B leading to a defect in the recruitment of perivascular cells PMID: 15838875
  46. PDGF-BB induces phosphorylation of alphaB-crystallin via p38 MAP kinase during myocardial infarction PMID: 15907784
  47. Our studies identify two independent negative immune regulatory pathways-PDGF-B and SOCS-that may help limit lesion expansion. PMID: 16127167
  48. PDGF-BB and TGF-beta1 binding to intact alpha2M is specific, involving a defined region of the alpha2M subunit PMID: 16641085
  49. platelet-derived growth factor B has a role in anti-vascular endothelial growth factor therapy in multiple models of ocular neovascularization PMID: 16723717
  50. PDGF-B overexpression causes liver fibrosis without significantly upregulating TGF-beta1, suggesting a TGF-beta-independent mechanism. PMID: 16842882

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PDGF/VEGF growth factor family
Tissue Specificity
Localized to vascular smooth muscle cells. Also weakly expressed by cortical interstitial cells but absent in tubules. Up-regulated in areas of renal fibrosis. In mice with unilateral ureteral obstruction, an increased expression in interstitial cells and
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*