Product Details

Purity

≥95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

Nrg4

Uniprot No.

Q9WTX4

Research Area

Cardiovascular

Alternative Names

Pro-NRG4;Nrg4

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

1-62aa

Target Protein Sequence

MPTDHEQPCGPRHRSFCLNGGICYVIPTIPSPFCRCIENYTGARCEEVFLPSSSIPSESNLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.8 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Low affinity ligand for the ERBB4 tyrosine kinase receptor. Concomitantly recruits ERBB1 and ERBB2 coreceptors, resulting in ligand-stimulated tyrosine phosphorylation and activation of the ERBB receptors. Does not bind to the ERBB1, ERBB2 and ERBB3 receptors.

Gene References into Functions

The found of this study showed that NRG4 is a major novel regulator of dendritic arborisation in the developing cerebral cortex and suggest that it exerts its effects by an autocrine/paracrine mechanism. PMID: 29317193
Conditional knockout of Nrg4 in brown adipocytes caused blood vessel reduction in brown but not in white adipose tissue , and was sufficient to induce obese phenotype. PMID: 29902456
Nrg4 exerts beneficial effects on energy balance and glucose and lipid metabolism to ameliorate obesity-associated metabolic disorders. PMID: 28752050
overexpression of the Nrg4 gene by hydrodynamic gene delivery prevents high fat diet-induced weight gain and fatty liver, alleviates obesity-induced chronic inflammation and insulin resistance PMID: 27184920
Pharmacological inhibition of PI3K/Akt signaling reversed the anti-apoptotic effects of NRG4, confirming the role of this cascade in NRG4-induced cell survival PMID: 23033483

Hide All

Subcellular Location

[Pro-neuregulin-4, membrane-bound isoform]: Cell membrane; Single-pass type I membrane protein.; [Neuregulin-4]: Secreted.

Protein Families

Neuregulin family

Tissue Specificity

Highly expressed in pancreas; weakly expressed in muscle.

Database Links

KEGG: mmu:83961

STRING: 10090.ENSMUSP00000115247

UniGene: Mm.443874

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP894816MO
Abbreviation	Recombinant Mouse Nrg4 protein, partial
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Pro-neuregulin-4, membrane-bound isoform (Nrg4), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage