Recombinant Mouse Protein FAM3B (Fam3b)

In Stock
Code CSB-MP861530MO
Abbreviation Recombinant Mouse Fam3b protein
MSDS
Size $190
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cytokine
Alternative Names
Cytokine-like protein 2-21 Pancreatic-derived factor Short name: PANDER
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
30-235aa
Target Protein Sequence
ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
51.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The process for producing recombinant Mouse Fam3b protein in mammalian cells follows a sequence of steps: creating the expression vector that codes for the Mouse Fam3b protein (30-235aa), introducing it into mammalian cells, cultivating and inducing of positive cells for protein expression, lysing cells, and conducting expression analysis. The resultant recombinant Mouse Fam3b protein is purified from the cell lysate using affinity purification, with its purity exceeding 90%, as determined by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.
Gene References into Functions
  1. these findings indicate that intestinal L cells are responsive to PANDER, and elevated PANDER levels impair GLP-1 production in vitro and in vivo. PMID: 28549991
  2. in-vitro and in-vivo glucose is a potent stimulator of the PANDER promoter within the liver and this response may be facilitated by ChREBP. PMID: 26123584
  3. F3MB(PANDER) decreases mice hepatic triglyceride and is associated with decreased DGAT1 expression PMID: 25679806
  4. X-ray crystal structure of the mouse FAM3B protein. PMID: 23333428
  5. these results demonstrated that the JNK-mediated signaling mechanism of palmitic acid -induced beta-cell apoptosis involves up-regulated expression of PANDER and activation of caspase-3. PMID: 22542939
  6. Data suggest a new link between the endocrine and immune systems and provide useful information for further investigating the physiological functions of PANDER and its involvement in inflammation-related pancreatic disorders. PMID: 21664946
  7. Palmitic acid induces the expression of PANDER and the apoptosis of beta-TC3 cells while glucagon-like peptide-1 counteracts the above effects through an activation of Akt signaling. PMID: 21756815
  8. PANDER promotes lipogenesis and compromises insulin signaling in the liver by increasing FOXO1 activity. PMID: 21412813
  9. Findings further indicate PANDER impacts glycemic levels and may represent a potential but complicated therapeutic target. PMID: 21486565
  10. A paracrine/endocrine effect of insulin on Pander release and a potential glucose-regulatory role for Pander. PMID: 20638985
  11. we provide evidence that identifies PANDER as a regulator of hepatic glucose metabolism, where it amplifies hepatic cAMP and cAMP-response element-binding protein signaling to induce gluconeogenic gene expression and glucose output. PMID: 20844005
  12. Potential role of PANDER in the pancreatic beta-cell for regulation or facilitation of insulin secretion, shown in PANDER knockout mice. PMID: 20566664
  13. In conclusion, Ad-PANDER infection is as effective as truncated recombinant PANDER to induce betaTC3 cell and mouse islet apoptosis. PMID: 15928025
  14. Because FAM3B (PANDER) mRNA expression is up-regulated by IFNgamma, a cytokine implicated in the pathogenesis of type 1 diabetes, PANDER may contribute to the pathogenesis of beta-cell death. (FAM3B) PMID: 16006032
  15. Tissue-specific and glucose-responsive expression of FAM3B promoter were studied. PMID: 16102856
  16. Because PANDER (FAM3B) is expressed by pancreatic beta-cells and in response to glucose in a similar way to those of insulin, PANDER may be involved in glucose homeostasis PMID: 17962352
  17. PANDER is a potential PDX-1 target gene and the A box sites within the promoter region are critical for basal and glucose-stimulated PANDER expression. PMID: 18708173
  18. liver is a target for PANDER, and PANDER may be involved in the progression of diabetes by regulating hepatic insulin signaling pathways. PMID: 19683528

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
FAM3 family
Tissue Specificity
Expressed at high levels in the pancreas and, to a lesser extent, in small intestine and prostate. Also detected in stomach, testis and fetal liver. In the pancreas, localized in the islets of Langerhans; in the testis, found primarily in the round sperma
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*