Recombinant Mouse Resistin-like alpha (Retnla)

In Stock
Code CSB-EP880616MO
Abbreviation Recombinant Mouse Retnla protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Retnla
Uniprot No.
Research Area
Others
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
24-111aa
Target Protein Sequence
DETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.3 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Citations

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable hormone. Plays a role in pulmonary vascular remodeling.
Gene References into Functions
  1. Reconstituting RELMalpha in CD301b(+) MNP-depleted animals restored body weight. PMID: 27566941
  2. These data demonstrate that RELMalpha but not RELMbeta significantly impacts the immune response to N. brasiliensis infection by downregulating the Th2 adaptive immune response in the lung. PMID: 26831469
  3. HIMF can induce HIF-1, vascular endothelial growth factor-A, and interleukin-6, which are critical mediators of both hypoxic inflammation and PH pathophysiology. PMID: 26586659
  4. FIZZ1 induction of adipocyte transdifferentiation to myofibroblast might be a key pathogenic mechanism for the accumulation of myofibroblasts in dermal fibrosis PMID: 26261086
  5. The expression of FIZZ1 was significantly elevated in the lungs of ovalbumin-challenged animals compared to controls. PMID: 25655389
  6. Relm-alpha is one important player in the pathway from IL-4Ralpha signaling in macrophages to the induction of lysyl hydroxylase 2 that directs persistent pro-fibrotic collagen cross-links, in fibroblasts. PMID: 26474656
  7. The adipokine Retnla modulates cholesterol homeostasis in hyperlipidemic mice PMID: 25022542
  8. RELMalpha is involved in immune response-induced pulmonary vascular remodeling and the associated increase in inflammation. PMID: 25569618
  9. results indicates that Retnla protects against Th2-mediated inflammation in an experimental mouse model of asthma, suggesting that therapeutic approaches to enhance the production of Retnla could be valuable for preventing allergic lung inflammation PMID: 25415454
  10. Authors show that in addition to promoting Th17 cytokine responses, RELMalpha inhibits Th2 cytokine expression and Th2-cytokine effector macrophage responses in the Citrobacter rodentium-infected colons. PMID: 24831469
  11. Low FIZZ1 expression is associated with dermal wounds. PMID: 24636235
  12. FIZZ1 exhibited profibrogenic properties essential for bleomycin induced pulmonary fibrosis. PMID: 24516640
  13. Hypoxia-induced mitogenic factor contributes to activation of vascular inflammation at least in part by inducing endothelial cell apoptosis in the lung PMID: 24793164
  14. Murine primary macrophages treated with HDL showed increased gene expression for the M2 markers Arginase-1 (Arg-1) and Fizz-1 PMID: 23991225
  15. RELMalpha may be involved in stem cell proliferation in the lung, without affecting differentiation potential. PMID: 22891677
  16. Show that pulmonary vascular remodeling in mice induced by chronic hypoxia or antigen challenge is associated with marked increases in HIMF expression. PMID: 23289668
  17. Macrophages undergoing interleukin-4 (IL-4)-induced alternative activation in the presence of hemozoin developed a phenotype specifically lacking in Retnla. PMID: 23090958
  18. Resistin-like molecule alpha promotes pathogenic Th17 cell responses and bacterial-induced intestinal inflammation. PMID: 23355735
  19. identify a largely redundant functional role for Relm-alpha in acute experimental models of allergen-associated Th2 immune responses PMID: 22246861
  20. Bone marrow mesenchymal stem cells transplantation improved LPS-induced lung injury independent of hypoxia-induced mitogenic factor PMID: 21477220
  21. FIZZ1 regulates tracheal smooth muscle contraction through impairment of the epithelium and activation of the mitogen-activated protein kinase pathway in muscle PMID: 20413533
  22. IL-4 signaling may play a significant role in Hypoxia-induced mitogenic factor-induced lung inflammation and vascular remodeling. PMID: 20889544
  23. results demonstrate HIMF-dependent recruitment of bone marrow derived mesenchymal-like cells to the remodeling pulmonary vasculature PMID: 20582166
  24. the expression of resistin and RELMalpha are similarly regulated in adipose tissue despite the fact that RELMalpha is exclusively expressed in the stromal vascular fraction of adipose tissue and not in adipocytes PMID: 12145345
  25. RELM-alpha mRNA in white adipose tissue fell by approximately 40% in early lactation; might indicate a role for RELM-alpha in the metabolic adaptations of lactation. PMID: 12163041
  26. inhibits differentiation of preadipocytes into adipocytes; characterization of its oligomeric nature PMID: 12189153
  27. FIZZ1/RELMalpha is a hypoxia-induced mitogenic factor which increased pulmonary arterial pressure and vascular resistance more potently than either endothelin-1 or angiotensin II PMID: 12714564
  28. These results indicate a role for HIMF in lung development, possibly under the control of HIF-2, and suggest that HIMF regulates apoptosis and may participate in lung alveolarization and maturation. PMID: 15117738
  29. Our findings connect HIMF to signaling pathways that regulate inflammation, and thus reveal the critical roles that HIMF plays in lung inflammation. PMID: 16709959
  30. Recombinant HIMF upregulates fetal liver kinase-1 (Flk-1) expression in endothelial cells in a phosphatidylinositol-3 kinase/Akt protein kinase-NF-kappa B signaling pathway-dependent manner, and may play critical roles in pulmonary angiogenesis. PMID: 16872509
  31. These results indicate that hypoxia-induced mitogenic factor (HIMF) enhances angiogenesis by promoting proliferation and migration of endothelial cells via activation of the PI-3K/Akt pathways. PMID: 16982054
  32. Ets-1 is a developmentally expressed transcription factor, which plays important roles in the regulation of HIMF production in the developing lung. PMID: 17127463
  33. HIMF acts as a chemotatic molecule in stimulating the migration of myeloid cells through activation of the Bruton's tyrosine kinase pathway PMID: 17264170
  34. a central proinflammatory role for Relm-alpha in the regulation of colonic inflammation PMID: 19201890
  35. Deficient mice are used as a model of th2 cytokine-dependent lung inflammation. PMID: 19349464
  36. the Th2-inducible gene Retnla suppresses resistance to GI nematode infection, pulmonary granulomatous inflammation, and fibrosis by negatively regulating Th2-dependent responses. PMID: 19381262
  37. mouse HIMF can stimulate intracellular Ca(2+) release in human pulmonary artery smooth muscle cells through the PLC signaling pathway in an IP(3)- and tyrosine phosphorylation-dependent manner PMID: 19429774
  38. Resistin-like alpha negatively regulates Th2 immunity PMID: 19381262
  39. Retnla increases more in Mt1/2-deficient mice than in strain-matched control during acute lung injury PMID: 16166738

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Resistin/FIZZ family
Tissue Specificity
Highest levels in adipose tissue.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*