Recombinant Mouse Reticulon-3 (Rtn3), partial

In Stock
Code CSB-EP884153MO
Abbreviation Recombinant Mouse Rtn3 protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Rtn3
Uniprot No.
Research Area
Cancer
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
182-440aa
Target Protein Sequence
KDQEPKNPNKVPDGEDRSALDFGQSKAEHICTYSLSPSELPVASVEKDSPESPFEVIIDKATFDREFKDLYKENPNDLGGWAAHGDRESPADLLEMNDKLFPLRNKEAGRYPSSVLLGRQFSHTTAALEEVSRCVNDMHNFTNEILTWDLDPQAKQQANKTSCTTESTGLDRSELRSEIPVINLKTNPQQKMPVCSFNGSTPITKSTGDWTEAFTEGKPVRDYLSSTKEAGGNGVPGSSQLHSELPGSMPEKWVSGSGA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in membrane trafficking in the early secretory pathway. Inhibits BACE1 activity and amyloid precursor protein processing. May induce caspase-8 cascade and apoptosis. May favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. Induces the formation of endoplasmic reticulum tubules.
Gene References into Functions
  1. altered RTN3 levels can impact the axonal transport of BACE1 and demonstrate that reducing axonal transport of BACE1 in axons is a viable strategy for decreasing BACE1 in axonal terminals and, perhaps, reducing amyloid deposition. PMID: 24005676
  2. RTN3 negatively regulates autophagy to block the clearance of cytoplasmic PrP aggregates. PMID: 21119307
  3. results show that reticulon 3 may play a role in the trafficking of the synaptic adhesion-like molecules family of adhesion molecules PMID: 19681166
  4. cDNA of mouse reticulon 3 (mRTN3) was cloned. The gene was mapped at band B of chromosome 19. PMID: 11990451
  5. RTN3 isoforms may contribute, by as yet unknown mechanisms, to neuronal survival and plasticity PMID: 15350194
  6. Since other reports have shown that RTN4-A inhibits neuronal outgrowth and restricts the plasticity of the central nervous system, we speculate that RTN3-A1 might play certain roles in the central nervous system. PMID: 15946766
  7. Transgenic mice overexpressing reticulon 3 develop neuritic abnormalities. PMID: 17476306
  8. RTN3 co-immunoprecipitated with endogenous beta-site amyloid precursor protein-cleaving enzyme 1, confirming interactions between these two membrane proteins in the mouse brain PMID: 19284479

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Isoform 1, isoform 3, isoform 4 and isoform 5 are expressed in spinal cord. Isoform 1 is present in brain, where it is expressed in the neurons of cerebral cortex, hippocampus, hypothalamus and cerebellum (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*