Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Saa2; Serum amyloid A-2 protein [Cleaved into: Amyloid protein A; Amyloid fibril protein AA)]
Species
Mus musculus (Mouse)
Expression Region
20-122aa
Target Protein Sequence
GFFSFIGEAFQGAGDMWRAYTDMKEAGWKDGDKYFHARGNYDAAQRGPGGVWAAEKISDARESFQEFFGRGHEDTMADQEANRHGRSGKDPNYYRPPGLPAKY
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 20-122 constitute the expression domain of recombinant Mouse Saa2. The calculated molecular weight for this Saa2 protein is 15.6 kDa. This protein is generated in a e.coli-based system. The Saa2 coding gene included the N-terminal 6xHis tag, which simplifies the detection and purification processes of the recombinant Saa2 protein in following stages of expression and purification.
The mouse serum amyloid A-2 protein (Saa2) is a major acute-phase protein primarily produced in the liver in response to inflammatory stimuli such as infection, tissue injury, or cytokine signaling. It belongs to the serum amyloid A (SAA) family of proteins, which are involved in various immune responses and inflammatory processes. Saa2 is implicated in modulating inflammation, lipid metabolism, and the acute-phase response. Its expression is tightly regulated and can be induced by pro-inflammatory cytokines like IL-6 and TNF-α. Research on Saa2 spans areas such as inflammation, immune responses, and metabolic disorders, aiming to elucidate its role in health and disease, including its potential as a biomarker or therapeutic target for inflammatory conditions.
