Recombinant Mouse Sulfotransferase 1A1 (Sult1a1)

In Stock
Code CSB-EP022933MOb1
Abbreviation Recombinant Mouse Sult1a1 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Sult1a1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Sult1a1; St1a1; Stp; Stp1; Sulfotransferase 1A1; ST1A1; EC 2.8.2.1; Aryl sulfotransferase; Phenol sulfotransferase; Phenol/aryl sulfotransferase; mSTp1; ST1A4; Sulfokinase
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-291aa
Target Protein Sequence
MEPLRKPLVPVKGIPLIKYFAETMEQLQNFTAWPDDVLISTYPKSGTNWMSEIMDMIYQGGKLDKCGRAPVYARIPFLEFSCPGVPPGLETLKETPAPRIIKTHLPLSLLPQSLLDQKIKVIYVARNAKDVVVSYYNFYKMAKLHPDPGTWESFLENFMDGKVSYGSWYQHVKEWWELRRTHPVLYLFYEDMKENPKREIKKILEFLGRSLPEETVDLIVHHTSFKKMKENPMANYTTIPTEVMDHTIYPFMRKGTIGDWKNTFTVAQSEHFDAHYAKLMTGCDFTFRCQI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.0kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Presenting the Recombinant Mouse Sult1a1, a carefully synthesized protein tailored to advance your research in the field of Signal Transduction. This recombinant protein is derived from the Mouse species and corresponds to the full-length form of Sulfotransferase 1A1, widely recognized by other names such as ST1A1, Aryl sulfotransferase, Phenol sulfotransferase, ST1A4, and Sulfokinase. Produced in the E.coli system, this product delivers both accuracy and quality in your experimental outcomes.

The Recombinant Mouse Sult1a1 covers the entire sequence from the 1st to the 291st amino acid, providing you with the full-length version of the protein. It features an N-terminal 10xHis tag and a C-terminal Myc tag, aiding in the processes of purification and identification. The protein purity is over 85%, as established by SDS-PAGE, which validates the high-quality standards of our product. You can select either the liquid form or the lyophilized powder form based on your research needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of a wide variety of acceptor molecules bearing a hydroxyl or an amine groupe. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Displays broad substrate specificity for small phenolic compounds. Plays an important role in the sulfonation of endogenous molecules such as steroid hormones and 3,3'-diiodothyronin. Mediates the sulfate conjugation of a variety of xenobiotics, including the drugs acetaminophen and minoxidil. Mediates also the metabolic activation of carcinogenic N-hydroxyarylamines leading to highly reactive intermediates capable of forming DNA adducts, potentially resulting in mutagenesis.
Subcellular Location
Cytoplasm.
Protein Families
Sulfotransferase 1 family
Database Links
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*