Recombinant Mouse Synaptic vesicle glycoprotein 2A (Sv2a), partial

Code CSB-EP022978MO
Abbreviation Recombinant Mouse Sv2a protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Synaptic vesicle protein 2;Synaptic vesicle protein 2A;Calcium regulator SV2A
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
469-598aa
Target Protein Sequence
PDMIRHLQAVDYAARTKVFPGERVEHVTFNFTLENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCTFINTVFYNTDLFEYKFVNSRLVNSTFLHNKEGCPLDVTGTGEGAYMVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
22.1
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in the control of regulated secretion in neural and endocrine cells, enhancing selectively low-frequency neurotransmission. Positively regulates vesicle fusion by maintaining the readily releasable pool of secretory vesicles.; (Microbial infection) Receptor for C.botulinum neurotoxin type A (BoNT/A, botA); the toxin probably binds via extracellular loop 4.; (Microbial infection) Possible receptor for C.botulinum neurotoxin type D (BoNT/D, botD); BoNT/D does not bind to extracellular loop 4 as do BoNT/A and BoNT/E.; (Microbial infection) Receptor for C.botulinum neurotoxin type E (BoNT/E); the toxin probably binds via extracellular loop 4. It probably requires glycosylation of Asn-573.
Gene References into Functions
  1. observed alterations of SV2A expression in hippocampus are consistent with the hypothesis that SV2A absence favors epileptic seizures around postnatal day 7 PMID: 23937191
  2. Action potential- and Ca(2+) -dependent glutamatergic & GABAergic synaptic transmission are differentially altered in the hippocampus of SV2A-deficient mice, but the mechanism of exocytosis itself is not changed. PMID: 22847229
  3. study suggests that SV2A specifically regulates hilar GABAergic neurotransmission in the kindled hippocampus probably as a compensatory or prophylactic mechanism against kindling epileptogenesis PMID: 22266237
  4. Loss of synaptic vesicle glycoprotein 2a is associated with inhibition of tetanus neurotoxin into central neurons. PMID: 21124874
  5. These results indicate that SV2 performs at least two actions at the synapse that contribute to neurotransmitter release. PMID: 20702688
  6. SV2A is selectively localized in motor nerve terminals on slow (type I and small type IIA) muscle fibers. PMID: 20843861
  7. SV2 action modulates synaptic networks by ensuring that low-frequency neurotransmission is faithfully conveyed. PMID: 16436618
  8. findings show that botulinum neurotoxin (BoNT/A) enters neurons by binding to the synaptic vesicle protein SV2 (isoforms A, B, and C);SV2 acts as the protein receptor for BoNT/A PMID: 16543415
  9. This study provides the first direct structural data on SV2A, and supports a transporter function suggested by sequence homology to MFS class of transporter proteins. PMID: 18692481
  10. Data demonstrate that glycosylated SV2A and SV2B act in conjunction with gangliosides to mediate the entry of BoNT/E into neurons. PMID: 18815274
  11. SV2A (+/-) mice display significant increased avoidance of open elevated arms, and increased avoidance of the lit area during the first sessions of passive avoidance procedure without foot shock. PMID: 19041904

Show More

Hide All

Subcellular Location
Cell junction, synapse, presynapse. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.
Protein Families
Major facilitator superfamily
Tissue Specificity
Expressed in conventional synapses and cone ribbon synapses in the retina (at protein level). Expressed in diaphragm motor nerve terminals (at protein level). Expressed in hippocampus neurons (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*