Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Thbs2

Uniprot No.

Q03350

Research Area

Others

Alternative Names

Thbs2; Tsp2; Thrombospondin-2

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

19-232aa

Target Protein Sequence

GDHVKDTSFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRFDYIPPVNTDDLNRIVKLARRKEGFFLTAQLKQDRKSRGTLLVLEGPGTSQRQFEIVSNGPGDTLDLNYWVEGNQHTNFLEDVGLADSQWKNVTVQVASDTYSLYVGCDLIDSVTLEEPFYEQLEVDRSRMYVAKGASRESHFRGLLQNVHLVFADSVEDILSKKGCQHSQGA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.1kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Thbs2 protein is produced by constructing the recombinant plasmid encoding the Mouse Thbs2 protein (19-232aa), transforming recombinant plasmid into e.coli cells, screening the positive e.coli cells and culturing them, and inducing the protein expression. The protein is equipped with a N-terminal 6xHis tag. Following expression, the recombinant Thbs2 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant Mouse Thbs2 protein. Its purity is greater than 90%.

Target Background

Function

Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.

Gene References into Functions

Data provide evidence that TSP2 transcription is suppressed by hypoxia through a mechanism that requires HIF-1alpha. PMID: 28789925
TWIST2 induces miR-221-3p expression and consequently suppresses its direct target, THBS2, in lymphatic metastasis cervical cancer. PMID: 29242498
TSP2 deficiency imparted a brittle phenotype on cortical bone. electron microscopy revealed less intensely stained collagen fibrils with altered morphology in the extracellular matrix assembled by osteoblasts on the anterior surface of TSP2-KO femora. PMID: 26272319
Enhanced levels of TSP-2 in the skin result in reduced susceptibility to chemically-induced skin carcinogenesis. PMID: 24507936
in the context of osteoblast differentiation, TSP2 promotes the assembly of a type-I collagen-rich matrix by facilitating pro-collagen processing. PMID: 23763373
The proposed mechanism for the shift in stem cell fate in fracture healing is that increased vascular density and hence oxygen availability in TSP2-null mice regulates differentiation. PMID: 23775935
The upregulation of TSP-2 mediated by increased oxidative stress contributes to angiogenesis dysfunction in diabetic bone marrow derived angiogenic cells. PMID: 23723366
TSP2 is a negative regulator of ischemic fracture healing, and in the absence of TSP2 bone regeneration is enhanced. PMID: 23280580
Using a TSP-2-knockout mouse model and cardiac cell transplantation, we found significantly reduced fibrosis and increased endothelial cell density in the peri-graft region. PMID: 22512900
the two TSP2 isforms are differentially modulated at injured and noninjured skeletal sites in an animal undergoing fracture healing. PMID: 22362307
TSP-2 has a protective role against cardiac inflammation, injury, and dysfunction in acute viral myocarditis. PMID: 22308237
astrocyte-derived TSP-2 is critical for the maintenance of physiological MMP-2 and MMP-9 levels during the foreign body response and contributes to the repair of the BBB PMID: 21704005
Endothelial nitric oxide synthase controls the expression of the angiogenesis inhibitor thrombospondin 2 PMID: 21949402
The secreted protein is an autocrine inhibitor of marrow stromal cell proliferation. PMID: 11874233
Megakaryocytes require this protein for normal platelet formation and function. PMID: 12732502
Thrombospondin 2 regulates cell proliferation induced by Rac1 redox-dependent signaling PMID: 12861025
TSP2-null mice provide an animal model to assist in the understanding of the molecular basis of spontaneous, premature softening of the uterine cervix. PMID: 14561659
Delay in expression of TSP2 and metalloproteinase 2 in the wounds of aged mice could contribute to their impaired rate of wound healing. PMID: 14996433
CD36 mediates the antiangiogenic effect of thrombospondin-2, which is modulated by histidine-rich glycoprotein PMID: 15748999
the absence of TSP2 protects against ovariectomy-induced bone loss by two complementary processes: increased formation and decreased resorption. PMID: 15979292
Mutations targeting intermodular interfaces or calcium binding destabilize the thrombospondin-2 signature domain. PMID: 18682400
TSP-2 was found to be present in some, but not all, annulus cells of the human annulus and the mouse annulus. PMID: 18718009
Taken together, our observations support a role for TSP2 as critical determinant of the brain response to biomaterials. PMID: 19020342
TSP-2 expression in the heart protects against age-dependent dilated cardiomyopathy. PMID: 19805649

Hide All

Protein Families

Thrombospondin family

Database Links

KEGG: mmu:21826

STRING: 10090.ENSMUSP00000128308

UniGene: Mm.26688

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP023488MO
Abbreviation	Recombinant Mouse Thbs2 protein, partial
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023488MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP023488MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Thbs2.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Thrombospondin-2 (Thbs2), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage