Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Fuca1

Uniprot No.

Q99LJ1

Research Area

Signal Transduction

Alternative Names

Fuca1; FucaTissue alpha-L-fucosidase; EC 3.2.1.51; Alpha-L-fucosidase I; Alpha-L-fucoside fucohydrolase 1; Alpha-L-fucosidase 1

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

18-452aa

Target Protein Sequence

LAPRRFTPDWQSLDSRPLPSWFDEAKFGVFVHWGVFSVPAWGSEWFWWHWQGDRMPAYQRFMTENYPPGFSYADFAPQFTARFFHPDQWAELFQAAGAKYVVLTTKHHEGFTNWPSPVSWNWNSKDVGPHRDLVGELGAAVRKRNIRYGLYHSLLEWFHPLYLLDKKNGFKTQHFVRAKTMPELYDLVNSYKPDLIWSDGEWECPDTYWNSTSFLAWLYNDSPVKDEVIVNDRWGQNCSCHHGGYYNCQDKYKPQSLPDHKWEMCTSMDRASWGYRKDMTMSTIAKENEIIEELVQTVSLGGNYLLNIGPTKDGLIVPIFQERLLAVGKWLQINGEAIYASKPWRVQSEKNKTVVWYTTKNATVYATFLYWPENGIVNLKSPKTTSATKITMLGLEGDLSWTQDPLEGVLISLPQLPPTVLPVEFAWTLKLTKVN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

66.6kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Mouse Fuca1 was expressed with the amino acid range of 18-452. This Fuca1 protein is expected to have a theoretical molecular weight of 66.6 kDa. Expression of this Fuca1 protein is conducted in e.coli. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of Fuca1, making it easier to detect and purify the Fuca1 recombinant protein in the later stages of expression and purification.

Mouse tissue alpha-L-fucosidase (Fuca1) is an enzyme crucial for the hydrolysis of alpha-L-fucosidic linkages in various glycoconjugates. Encoded by the Fuca1 gene, this lysosomal enzyme plays a key role in the catabolism of fucose-containing glycoproteins and glycolipids. Fuca1 is expressed in various tissues, with higher levels found in the liver, kidney, and spleen. Its activity contributes to the degradation of complex carbohydrates, participating in cellular homeostasis. Deficiencies in Fuca1 are associated with fucosidosis, a lysosomal storage disorder characterized by the accumulation of fucose-containing compounds. The study of Fuca1 in mouse models provides insights into lysosomal function, glycoprotein metabolism, and the pathological mechanisms underlying fucosidosis, contributing to research in lysosomal storage disorders and potential therapeutic strategies for these conditions.

Target Background

Function

Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.

Subcellular Location

Lysosome.

Protein Families

Glycosyl hydrolase 29 family

Database Links

KEGG: mmu:71665

STRING: 10090.ENSMUSP00000030434

UniGene: Mm.439940

Code	CSB-EP858759MO
Abbreviation	Recombinant Mouse Fuca1 protein
MSDS	MSDS Datasheet
Size	US$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Tissue alpha-L-fucosidase (Fuca1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage