Recombinant Mouse Tumor necrosis factor receptor type 1-associated DEATH domain protein(Tradd)

In Stock
Code CSB-EP659708MO
Abbreviation Recombinant Mouse Tradd protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
TNFR1-associated DEATH domain protein;TNFRSF1A-associated via death domain
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-310aa
Target Protein Sequence
MAAGQNGHEEWVGSAYLFLESAVDKVILSEAYTDPKKKVAIYKALQTALSESGDSSDVLQILKIHCSDPQLIVQLRFCGRVLCGRFLQAYREGALRTALQRCMAPALAQEALRLQLELRAGAEQLDSWLTDEERCLNYILAQKPDRLRDEELAELEDELCKLTCDCTGQGGAIQVASAGSKFPVSSPTEEKPLPAACQTFLFHGQLVVNRPLTLQDQQTFARSVGLKWRRVGRSLQRNCRALRDPALDSLAYEYERDGLYEQAFQLLRRFMQAEGRRATLQRLVEALEENELTSLAEDLLGQAEPDGGLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.6 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter molecule for TNFRSF1A/TNFR1 that specifically associates with the cytoplasmic domain of activated TNFRSF1A/TNFR1 mediating its interaction with FADD. Overexpression of TRADD leads to two major TNF-induced responses, apoptosis and activation of NF-kappa-B. The nuclear form acts as a tumor suppressor by preventing ubiquitination and degradation of isoform p19ARF/ARF of CDKN2A by TRIP12: acts by interacting with TRIP12, leading to disrupt interaction between TRIP12 and isoform p19ARF/ARF of CDKN2A.
Gene References into Functions
  1. TRADD knockout blunts pressure overload-induced cardiac hypertrophy through mediating TAK1/p38 MAPK but not AKT phosphorylation PMID: 28013046
  2. Data indicate that ASK1 activation stimulated the activity of the transcription factor FoxO3a, which increased the abundance of the apoptosis-promoting adaptor protein TRADD, leading to activation of caspase 8. PMID: 23982205
  3. data indicate that TRADD shuttles dynamically from the cytoplasm into the nucleus to modulate the interaction between p19(Arf) and its E3 ubiquitin ligase ULF, thereby promoting p19(Arf) protein stability and tumour suppression PMID: 22561347
  4. Data suggest that deficiency of TRADD sensitizes cells to TRAIL-induced apoptosis, and that enhanced cell death in TRADD(-/-) MEFs is associated with defective NF-kappaB activation. PMID: 21627969
  5. TRADD is required for recruitment of receptor interacting protein 1 and TNFR-associated factor 2 to the DR3 signaling complex and for the ubiquitination of receptor interacting protein 1 PMID: 21421854
  6. We show that TRADD is recruited to the TRAIL-receptor complex, and RIP1 recruitment is mediated by TRADD. PMID: 21187341
  7. TRADD may be involved in IFN-gamma signaling by forming a complex with STAT1-alpha within the nucleus and regulating IFN-gamma-mediated STAT1-alpha activation. PMID: 14730360
  8. Tradd activates distinct mechanisms of apoptosis from the nucleus and the cytoplasm. PMID: 15761471
  9. silencing TRADD expression with small-interfering RNA reduced neuronal apoptosis and subsequent microglial and astroglial activation PMID: 18325634
  10. TRADD is a multifunctional protein crucial both for TNFR1 signaling and other signaling pathways relevant to immune responses. PMID: 18719121

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Cytoplasm, cytoskeleton.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*