Recombinant Mouse Uroplakin-2(Upk2)

Code CSB-EP025656MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P38575
Relevance Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025656MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025656MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Research Area Signal Transduction
Source E.coli
Gene Names Upk2
Protein Names Uroplakin II
Expression Region 85-184aa
Tag Info N-terminal 6xHis-GST-tagged
Mol. Weight 40.8 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Uroplakin-2 family
Database Links

STRING: 10090.ENSMUSP00000040481

UniGene: Mm.4453

Related Products

Upk2 Antibodies

Upk2 Antibodies for Mus musculus (Mouse)

Upk2 Proteins

Upk2 Proteins for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.