Recombinant Mouse Uroplakin-2 (Upk2)

^{In Stock}

Code	CSB-EP025656MO
Abbreviation	Recombinant Mouse Upk2 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025656MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP025656MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Upk2.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

Upk2

Uniprot No.

P38575

Research Area

Signal Transduction

Alternative Names

Upk2; Uroplakin-2; UP2; Uroplakin II; UPII

Species

Mus musculus (Mouse)

Source

E.coli

Expression Region

85-184aa

Target Protein Sequence

ELVSVVDSGSGYTVTRLSAYQVTNLTPGTKYYISYRVQKGTSTESSPETPMSTLPRKNMESIGLGMARTGGMVVITVLLSVAMFLLVVGLIVALHWDARK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

40.8 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The Recombinant Mouse Upk2 is an outstanding quality recombinant protein, meticulously produced for your advanced research needs. This protein echoes the characteristics of Uroplakin-2, also known as UP2, Uroplakin II, or UPII, as found in the Mouse species. Expertly generated in an E.coli expression system, this full-length mature protein provides a reliable representation of the natural protein structure, giving you confidence in your experimental results.

The Recombinant Mouse Upk2 encompasses the 85th to the 184th amino acid sequence of the native protein. It comes with an N-terminal 6xHis-GST-tag, offering efficient purification and detection procedures. The purity of this protein exceeds 90%, as validated by SDS-PAGE, ensuring a high-quality product for your research endeavors. The Recombinant Mouse Upk2 is available in both liquid and lyophilized powder forms to best suit your laboratory and storage requirements.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Component of the asymmetric unit membrane (AUM); a highly specialized biomembrane elaborated by terminally differentiated urothelial cells. May play an important role in regulating the assembly of the AUM.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Uroplakin-2 family

Database Links

STRING: 10090.ENSMUSP00000040481

UniGene: Mm.4453

Promotions