Recombinant Mouse Zinc finger protein 346 (Znf346)

In Stock
Code CSB-EP026691MO
Abbreviation Recombinant Mouse Znf346 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Znf346
Uniprot No.
Research Area
Others
Alternative Names
Znf346; Jaz; Zfp346Zinc finger protein 346; Just another zinc finger protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-294aa
Target Protein Sequence
MECPAPDATDAADPGEAGPYKGSEEPEGREPDGVRFDRERARRLWEAVSGAQPAGREEVEHMIQKNQCLFTSTQCKVCCAMLISESQKLAHYQSKKHANKVKRYLAIHGMETIKGDVKRLDSDQKSSRSKDKNHCCPICNMTFSSPAVAQSHYLGKTHAKSLKLKQQSTKGAALQQNREMLDPDKFCSLCHSTFNDPAMAQQHYMGKRHRKQETKLKLMAHYGRLADPAVSDLPAGKGYPCKTCKIVLNSIEQYQAHVSGFKHKNQSPKTLVTLGSQTPVQTQPTPKDSSTVQD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse Zinc finger protein 346 (Znf346) is produced in E.coli and includes the complete expression region spanning amino acids 1-294. The protein carries an N-terminal 6xHis-SUMO tag, which appears to improve both purification efficiency and overall stability. SDS-PAGE analysis confirms purity levels exceeding 90%, making it well-suited for detailed research applications. This product is designed exclusively for research purposes and should not be used for human or clinical applications.

Zinc finger protein 346 (Znf346) belongs to the zinc finger protein family, a group recognized for its DNA-binding capabilities and roles in transcription regulation. Znf346 participates in several cellular processes, including gene expression control and RNA binding, which may explain its growing importance in studies focused on gene regulation and cellular signaling networks. This protein seems particularly useful for researchers trying to understand how transcriptional control actually works.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Znf346 is a zinc finger protein that requires precise folding around zinc ions and proper tertiary structure for its nucleic acid-binding function. The E. coli expression system can produce soluble proteins, and the SUMO tag may enhance solubility. However, zinc finger proteins often require specific chaperones and zinc availability for correct folding. While the full-length protein (1-294aa) contains all functional domains, the correct folding with functional nucleic acid-binding activity requires experimental validation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

Protein-protein interactions depend on native conformation. The full-length design supports interaction studies if proper folding is confirmed. If correctly folded, Znf346 could identify physiological interaction partners. However, misfolding may lead to non-specific binding or failure to recognize genuine partners. The SUMO tag may sterically hinder some interactions. Results require validation with an endogenous protein.

2. Antibody Development and Validation

This recombinant Znf346 serves as an excellent immunogen for generating antibodies against mouse Znf346. The full-length sequence ensures comprehensive epitope coverage. The His-SUMO tag facilitates purification and immunization procedures.

3. Biochemical Characterization and Stability Studies

This is the essential first step to assess protein quality. Techniques like size-exclusion chromatography can determine oligomeric state, while circular dichroism can analyze secondary structure and zinc-dependent folding. These studies provide critical quality control data about the protein's folding state and stability.

4. In Vitro Binding Assays with Nucleic Acids

Functional nucleic acid binding is entirely dependent on correct zinc finger domain folding. Nucleic acid binding requires precise tertiary structure formation around zinc ions. If properly folded, EMSA and SPR assays could reveal binding specificity. However, misfolding would yield false negatives or non-specific binding.

Final Recommendation & Action Plan

This recombinant Znf346 has potential for functional applications but requires rigorous folding validation before reliable use in interaction or binding studies. The immediate priority is Application 3 (Biochemical Characterization) to confirm proper folding through zinc supplementation assays and structural analysis. Application 2 (Antibody Development) can proceed immediately. Applications 1 and 4 should only be attempted after confirming correct folding through biophysical methods. For all functional applications, ensure adequate zinc availability in buffers to maintain structural integrity. This systematic approach ensures reliable interpretation of experimental outcomes.

Citations

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : In vitro binding assay

Review: Dependence of the amperometric responses measured in the absence (white bars) or in the presence (gray bars) of 50 nM miR-21 and the resulting signal to blank (S/B, red lines) current ratios as a function of the ZFP.

By Anonymous

Target Background

Function
Binds with low affinity to dsDNA and ssRNA, and with high affinity to dsRNA, with no detectable sequence specificity. May bind to specific miRNA hairpins.
Subcellular Location
Nucleus, nucleolus. Cytoplasm.
Tissue Specificity
Expressed in all tissues tested, including heart, brain, spleen, lung, liver, muscle, kidney and testis. Exogenous expression induced apoptosis.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*