Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
fbpB; MT1934Diacylglycerol acyltransferase/mycolyltransferase Ag85B; DGAT; EC 2.3.1.122; EC 2.3.1.20; 30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; 85B; Ag85B; Extracellular alpha-antigen; Fibronectin-binding protein B; Fbps B
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Expression Region
41-325aa
Target Protein Sequence
FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Just like other recombinant proteins, the production of this recombinant M.tb fbpB protein began with appropriate cDNA and PCR methods, and then the fbpB expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into E.coli for the expression of the recombinant M.tb fbpB protein. N-terminal 6xHis tag was used in the process. And we finally get the protein of interest with purity of 85%+.
fbpB is a gene encoding a protein named Diacylglycerol acyltransferase/mycolyltransferase Ag85B in mycobacterium tuberculosis. This protein is also called 30 kDa extracellular protein, diacylglycerol acyltransferase, antigen 85 complex B (short name includes 85B and Ag85B), extracellular alpha-antigen and fibronectin-binding protein B (Fbps B). Ag85B is an immunogenic mycolyl transferase involved in the coupling of mycolic acids with arabinogalactan and is necessary for cell wall formation. An experiment has demonstrated that the production of IFN-gamma in the spleen cells increases in C57BL/6 mice subcutaneously immunized with recombinant fbpb protein.
