Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

fbpB

Uniprot No.

P9WQP0

Research Area

others

Alternative Names

fbpB; MT1934Diacylglycerol acyltransferase/mycolyltransferase Ag85B; DGAT; EC 2.3.1.122; EC 2.3.1.20; 30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; 85B; Ag85B; Extracellular alpha-antigen; Fibronectin-binding protein B; Fbps B

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Source

E.coli

Expression Region

41-325aa

Target Protein Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

36.2kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Just like other recombinant proteins, the production of this recombinant M.tb fbpB protein began with appropriate cDNA and PCR methods, and then the fbpB expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into E.coli for the expression of the recombinant M.tb fbpB protein. N-terminal 6xHis tag was used in the process. And we finally get the protein of interest with purity of 85%+.

fbpB is a gene encoding a protein named Diacylglycerol acyltransferase/mycolyltransferase Ag85B in mycobacterium tuberculosis. This protein is also called 30 kDa extracellular protein, diacylglycerol acyltransferase, antigen 85 complex B (short name includes 85B and Ag85B), extracellular alpha-antigen and fibronectin-binding protein B (Fbps B). Ag85B is an immunogenic mycolyl transferase involved in the coupling of mycolic acids with arabinogalactan and is necessary for cell wall formation. An experiment has demonstrated that the production of IFN-gamma in the spleen cells increases in C57BL/6 mice subcutaneously immunized with recombinant fbpb protein.

Target Background

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.

Subcellular Location

Secreted.

Protein Families

Mycobacterial A85 antigen family

Database Links

KEGG: mtc:MT1934

Code	CSB-EP314366MVZa0
Abbreviation	Recombinant Mycobacterium tuberculosis fbpB protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage