Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

In Stock
Code CSB-EP314366MVZa0
Abbreviation Recombinant Mycobacterium tuberculosis fbpB protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
fbpB
Uniprot No.
Research Area
others
Alternative Names
fbpB; MT1934Diacylglycerol acyltransferase/mycolyltransferase Ag85B; DGAT; EC 2.3.1.122; EC 2.3.1.20; 30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; 85B; Ag85B; Extracellular alpha-antigen; Fibronectin-binding protein B; Fbps B
Species
Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Source
E.coli
Expression Region
41-325aa
Target Protein Sequence
FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Just like other recombinant proteins, the production of this recombinant M.tb fbpB protein began with appropriate cDNA and PCR methods, and then the fbpB expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into E.coli for the expression of the recombinant M.tb fbpB protein. N-terminal 6xHis tag was used in the process. And we finally get the protein of interest with purity of 85%+.

fbpB is a gene encoding a protein named Diacylglycerol acyltransferase/mycolyltransferase Ag85B in mycobacterium tuberculosis. This protein is also called 30 kDa extracellular protein, diacylglycerol acyltransferase, antigen 85 complex B (short name includes 85B and Ag85B), extracellular alpha-antigen and fibronectin-binding protein B (Fbps B). Ag85B is an immunogenic mycolyl transferase involved in the coupling of mycolic acids with arabinogalactan and is necessary for cell wall formation. An experiment has demonstrated that the production of IFN-gamma in the spleen cells increases in C57BL/6 mice subcutaneously immunized with recombinant fbpb protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.
Subcellular Location
Secreted.
Protein Families
Mycobacterial A85 antigen family
Database Links

KEGG: mtc:MT1934

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*