Code | CSB-YP314366MVZ |
Abbreviation | Recombinant Mycobacterium tuberculosis fbpB protein |
MSDS | |
Size | $436 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
CUSABIO used yeast cells to express N-terminal 6xHis-tagged Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB). This recombinant fbpB protein is full-length of mature protein containing 41-325aa of mycobacterium tuberculosis fbpB. It underwent validation via LC-MS/MS analysis. Its purity reached up to 90% determined by SDS-PAGE. Under reducing conditions, a molecular weight band of around 33 kDa was visualized on the SDS-PAGE.
Ag85B, the fbpB encoding protein, is a component of the Ag85 complex that synthesizes the majority of Mycobacterium tuberculosis-secreted proteins. The proteins containing the Ag85 complex play a crucial role in the final step of cell wall assembly and the maintenance of the bacterial cell envelope integrity. This effect is carried out by catalysis of the biosynthesis of abundant cell envelope components, including TMM and TDM. Also, the Ag85 complex is involved in the synthesis of trehalose dimycolate. The Mycobacterium tuberculosis Ag85 complex has been demonstrated to stimulate a strong humoral- and cell-mediated immune response.
There are currently no reviews for this product.
I am interested in using cat # CSB-YP314366MVZ.
Would it be possible to know the concentration product when provided in liquid format?
FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
KEGG: mtc:MT1934