Home
Protein
Recombinant Protein
Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB)

^{In Stock}

Code	CSB-YP314366MVZ
MSDS	MSDS
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP314366MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpB. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP314366MVZ could indicate that this peptide derived from Yeast-expressed Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) fbpB.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

fbpB

Uniprot No.

P9WQP0

Alternative Names

fbpB; MT1934Diacylglycerol acyltransferase/mycolyltransferase Ag85B; DGAT; EC 2.3.1.122; EC 2.3.1.20; 30 kDa extracellular protein; Acyl-CoA:diacylglycerol acyltransferase; Antigen 85 complex B; 85B; Ag85B; Extracellular alpha-antigen; Fibronectin-binding protein B; Fbps B

Species

Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

Source

Yeast

Expression Region

41-325aa

Target Protein Sequence

FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

32.7kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CUSABIO used yeast cells to express N-terminal 6xHis-tagged Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B (fbpB). This recombinant fbpB protein is full-length of mature protein containing 41-325aa of mycobacterium tuberculosis fbpB. It underwent validation via LC-MS/MS analysis. Its purity reached up to 90% determined by SDS-PAGE. Under reducing conditions, a molecular weight band of around 33 kDa was visualized on the SDS-PAGE.

Ag85B, the fbpB encoding protein, is a component of the Ag85 complex that synthesizes the majority of Mycobacterium tuberculosis-secreted proteins. The proteins containing the Ag85 complex play a crucial role in the final step of cell wall assembly and the maintenance of the bacterial cell envelope integrity. This effect is carried out by catalysis of the biosynthesis of abundant cell envelope components, including TMM and TDM. Also, the Ag85 complex is involved in the synthesis of trehalose dimycolate. The Mycobacterium tuberculosis Ag85 complex has been demonstrated to stimulate a strong humoral- and cell-mediated immune response.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am interested in using cat # CSB-YP314366MVZ.
Would it be possible to know the concentration product when provided in liquid format?

Code: CSB-YP314366MVZ
Name: Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B(fbpB)
Expression Region: 41-325aa; Full Length of Mature Protein
Tag Info: N-terminal 6xHis-tagged
Expression Sequence:

Product Type: Developed Recombinant Protein

Target Background

Function

The antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria for fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM.

Subcellular Location

Secreted.

Protein Families

Mycobacterial A85 antigen family

Database Links

KEGG: mtc:MT1934

Promotions